Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 246593..247144 Replicon chromosome
Accession NZ_CP118043
Organism Streptococcus agalactiae strain VSI63

Toxin (Protein)


Gene name relE Uniprot ID A0A7Z6WID7
Locus tag PUW57_RS01450 Protein ID WP_000285204.1
Coordinates 246593..246871 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A7Z6WI90
Locus tag PUW57_RS01455 Protein ID WP_000246822.1
Coordinates 246872..247144 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUW57_RS01415 (PUW57_01415) 241670..242056 - 387 WP_000058816.1 hypothetical protein -
PUW57_RS01420 (PUW57_01420) 242034..243266 - 1233 WP_000625216.1 replication initiation factor domain-containing protein -
PUW57_RS01425 (PUW57_01425) 243478..245136 - 1659 WP_001882899.1 FtsK/SpoIIIE domain-containing protein -
PUW57_RS01430 (PUW57_01430) 245143..245553 - 411 WP_000216328.1 DUF961 family protein -
PUW57_RS01435 (PUW57_01435) 245576..245890 - 315 WP_000406626.1 hypothetical protein -
PUW57_RS01440 (PUW57_01440) 246004..246231 - 228 WP_001105756.1 hypothetical protein -
PUW57_RS01445 (PUW57_01445) 246228..246464 - 237 WP_001000876.1 hypothetical protein -
PUW57_RS01450 (PUW57_01450) 246593..246871 - 279 WP_000285204.1 type II toxin-antitoxin system YafQ family toxin Toxin
PUW57_RS01455 (PUW57_01455) 246872..247144 - 273 WP_000246822.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PUW57_RS01460 (PUW57_01460) 247825..248187 + 363 WP_000483806.1 helix-turn-helix domain-containing protein -
PUW57_RS01465 (PUW57_01465) 248194..249045 + 852 WP_001189027.1 ImmA/IrrE family metallo-endopeptidase -
PUW57_RS01470 (PUW57_01470) 249065..249427 - 363 WP_000722890.1 hypothetical protein -
PUW57_RS01475 (PUW57_01475) 249515..251065 - 1551 WP_001145976.1 DNA cytosine methyltransferase -
PUW57_RS01480 (PUW57_01480) 251259..251720 + 462 WP_000443123.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 192393..253511 61118


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(1-90)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-79)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10954.81 Da        Isoelectric Point: 8.0384

>T272702 WP_000285204.1 NZ_CP118043:c246871-246593 [Streptococcus agalactiae]
MYQVKFTSTFKKSYKRIKKRGLEMTLLDEVIEKLRLGQTLEEKYRDHELKGNFVGFRECHIKPDWLLIYLIEDDILTLTL
ADTGSHADLFKM

Download         Length: 279 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9904.41 Da        Isoelectric Point: 6.2580

>AT272702 WP_000246822.1 NZ_CP118043:c247144-246872 [Streptococcus agalactiae]
MATVPTQIRIDETVKAQATSLFNDLGMDMSSAVNIFLRQCLLRGGLPFTVEVPNYSQKTLEALAEAKRISRDKTIASYDN
LADLKKALDA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Z6WID7

Antitoxin

Source ID Structure
AlphaFold DB A0A7Z6WI90

References