Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 2599761..2600412 | Replicon | chromosome |
| Accession | NZ_CP118035 | ||
| Organism | Lacticaseibacillus rhamnosus strain VSI33 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | K8Q4Y0 |
| Locus tag | PUW67_RS12065 | Protein ID | WP_005686631.1 |
| Coordinates | 2599761..2600144 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | K8QH19 |
| Locus tag | PUW67_RS12070 | Protein ID | WP_005686632.1 |
| Coordinates | 2600164..2600412 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW67_RS12060 (PUW67_12060) | 2598720..2599247 | - | 528 | WP_005691221.1 | QueT transporter family protein | - |
| PUW67_RS12065 (PUW67_12065) | 2599761..2600144 | - | 384 | WP_005686631.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PUW67_RS12070 (PUW67_12070) | 2600164..2600412 | - | 249 | WP_005686632.1 | antitoxin | Antitoxin |
| PUW67_RS12075 (PUW67_12075) | 2600524..2601663 | - | 1140 | WP_005691215.1 | alanine racemase | - |
| PUW67_RS12080 (PUW67_12080) | 2601650..2602024 | - | 375 | WP_005686634.1 | holo-ACP synthase | - |
| PUW67_RS12085 (PUW67_12085) | 2602193..2603701 | - | 1509 | WP_005686635.1 | DEAD/DEAH box helicase | - |
| PUW67_RS12090 (PUW67_12090) | 2603975..2605363 | - | 1389 | WP_014571607.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13757.03 Da Isoelectric Point: 10.9764
>T272700 WP_005686631.1 NZ_CP118035:c2600144-2599761 [Lacticaseibacillus rhamnosus]
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|