Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2502853..2503418 | Replicon | chromosome |
Accession | NZ_CP118035 | ||
Organism | Lacticaseibacillus rhamnosus strain VSI33 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | C2JYM4 |
Locus tag | PUW67_RS11595 | Protein ID | WP_005692155.1 |
Coordinates | 2502853..2503200 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PUW67_RS11600 | Protein ID | WP_020752297.1 |
Coordinates | 2503200..2503418 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW67_RS11575 (PUW67_11575) | 2498348..2499589 | - | 1242 | WP_005692160.1 | acyltransferase | - |
PUW67_RS11580 (PUW67_11580) | 2499586..2500287 | - | 702 | WP_005692159.1 | ATP-binding cassette domain-containing protein | - |
PUW67_RS11585 (PUW67_11585) | 2500280..2501098 | - | 819 | WP_014571588.1 | ABC transporter permease subunit | - |
PUW67_RS11590 (PUW67_11590) | 2501339..2502007 | - | 669 | WP_005692157.1 | phenylalanine--tRNA ligase beta subunit-related protein | - |
PUW67_RS11595 (PUW67_11595) | 2502853..2503200 | - | 348 | WP_005692155.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PUW67_RS11600 (PUW67_11600) | 2503200..2503418 | - | 219 | WP_020752297.1 | hypothetical protein | Antitoxin |
PUW67_RS11605 (PUW67_11605) | 2503512..2505347 | - | 1836 | WP_015764721.1 | ABC transporter ATP-binding protein | - |
PUW67_RS11610 (PUW67_11610) | 2505334..2507124 | - | 1791 | WP_015764722.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13150.01 Da Isoelectric Point: 7.9817
>T272699 WP_005692155.1 NZ_CP118035:c2503200-2502853 [Lacticaseibacillus rhamnosus]
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|