Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafQ-relB/YafQ-DinJ |
| Location | 1065388..1065968 | Replicon | chromosome |
| Accession | NZ_CP118032 | ||
| Organism | Lactobacillus gasseri strain VSI47 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | A0A249NKC7 |
| Locus tag | PUW43_RS05300 | Protein ID | WP_003647258.1 |
| Coordinates | 1065663..1065968 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A249NIV0 |
| Locus tag | PUW43_RS05295 | Protein ID | WP_021314843.1 |
| Coordinates | 1065388..1065663 (+) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW43_RS05265 (PUW43_05265) | 1061267..1062157 | - | 891 | WP_275017125.1 | GRP family sugar transporter | - |
| PUW43_RS05270 (PUW43_05270) | 1062184..1062579 | - | 396 | WP_003647263.1 | D-ribose pyranase | - |
| PUW43_RS05275 (PUW43_05275) | 1062688..1063137 | - | 450 | WP_003647262.1 | ASCH domain-containing protein | - |
| PUW43_RS05280 (PUW43_05280) | 1063140..1063904 | - | 765 | Protein_1032 | nucleoside phosphorylase | - |
| PUW43_RS05285 (PUW43_05285) | 1064031..1064519 | - | 489 | WP_003647261.1 | GNAT family N-acetyltransferase | - |
| PUW43_RS05290 (PUW43_05290) | 1064522..1065055 | - | 534 | WP_003647260.1 | GNAT family N-acetyltransferase | - |
| PUW43_RS05295 (PUW43_05295) | 1065388..1065663 | + | 276 | WP_021314843.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PUW43_RS05300 (PUW43_05300) | 1065663..1065968 | + | 306 | WP_003647258.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| PUW43_RS05305 (PUW43_05305) | 1066131..1066946 | - | 816 | WP_003647256.1 | Fic family protein | - |
| PUW43_RS05310 (PUW43_05310) | 1067091..1067879 | - | 789 | WP_003647255.1 | tyrosine-protein phosphatase | - |
| PUW43_RS05315 (PUW43_05315) | 1067948..1068217 | - | 270 | WP_225792982.1 | hypothetical protein | - |
| PUW43_RS05320 (PUW43_05320) | 1068252..1068971 | - | 720 | WP_003647253.1 | hypothetical protein | - |
| PUW43_RS05325 (PUW43_05325) | 1068978..1069337 | - | 360 | WP_003647252.1 | DUF6176 family protein | - |
| PUW43_RS05330 (PUW43_05330) | 1069330..1069632 | - | 303 | WP_003647251.1 | MazG-like family protein | - |
| PUW43_RS05335 (PUW43_05335) | 1069644..1070453 | - | 810 | WP_003647250.1 | DUF2785 domain-containing protein | - |
| PUW43_RS05340 (PUW43_05340) | 1070456..1070903 | - | 448 | Protein_1044 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11985.87 Da Isoelectric Point: 10.2029
>T272697 WP_003647258.1 NZ_CP118032:1065663-1065968 [Lactobacillus gasseri]
MAQINYTPQFKRDYKKLKRKHYDLNKLKNVIQLLIDEKFKILVDKYDDHQLKGSLRSLRALHVEHNKAGNWILVYKIHSG
NLELLTIDLVSTGSHDHTYRT
MAQINYTPQFKRDYKKLKRKHYDLNKLKNVIQLLIDEKFKILVDKYDDHQLKGSLRSLRALHVEHNKAGNWILVYKIHSG
NLELLTIDLVSTGSHDHTYRT
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249NKC7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249NIV0 |