Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafQ-relB/YafQ-DinJ
Location 1065388..1065968 Replicon chromosome
Accession NZ_CP118032
Organism Lactobacillus gasseri strain VSI47

Toxin (Protein)


Gene name yafQ Uniprot ID A0A249NKC7
Locus tag PUW43_RS05300 Protein ID WP_003647258.1
Coordinates 1065663..1065968 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A249NIV0
Locus tag PUW43_RS05295 Protein ID WP_021314843.1
Coordinates 1065388..1065663 (+) Length 92 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUW43_RS05265 (PUW43_05265) 1061267..1062157 - 891 WP_275017125.1 GRP family sugar transporter -
PUW43_RS05270 (PUW43_05270) 1062184..1062579 - 396 WP_003647263.1 D-ribose pyranase -
PUW43_RS05275 (PUW43_05275) 1062688..1063137 - 450 WP_003647262.1 ASCH domain-containing protein -
PUW43_RS05280 (PUW43_05280) 1063140..1063904 - 765 Protein_1032 nucleoside phosphorylase -
PUW43_RS05285 (PUW43_05285) 1064031..1064519 - 489 WP_003647261.1 GNAT family N-acetyltransferase -
PUW43_RS05290 (PUW43_05290) 1064522..1065055 - 534 WP_003647260.1 GNAT family N-acetyltransferase -
PUW43_RS05295 (PUW43_05295) 1065388..1065663 + 276 WP_021314843.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PUW43_RS05300 (PUW43_05300) 1065663..1065968 + 306 WP_003647258.1 type II toxin-antitoxin system YafQ family toxin Toxin
PUW43_RS05305 (PUW43_05305) 1066131..1066946 - 816 WP_003647256.1 Fic family protein -
PUW43_RS05310 (PUW43_05310) 1067091..1067879 - 789 WP_003647255.1 tyrosine-protein phosphatase -
PUW43_RS05315 (PUW43_05315) 1067948..1068217 - 270 WP_225792982.1 hypothetical protein -
PUW43_RS05320 (PUW43_05320) 1068252..1068971 - 720 WP_003647253.1 hypothetical protein -
PUW43_RS05325 (PUW43_05325) 1068978..1069337 - 360 WP_003647252.1 DUF6176 family protein -
PUW43_RS05330 (PUW43_05330) 1069330..1069632 - 303 WP_003647251.1 MazG-like family protein -
PUW43_RS05335 (PUW43_05335) 1069644..1070453 - 810 WP_003647250.1 DUF2785 domain-containing protein -
PUW43_RS05340 (PUW43_05340) 1070456..1070903 - 448 Protein_1044 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-97)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-88)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11985.87 Da        Isoelectric Point: 10.2029

>T272697 WP_003647258.1 NZ_CP118032:1065663-1065968 [Lactobacillus gasseri]
MAQINYTPQFKRDYKKLKRKHYDLNKLKNVIQLLIDEKFKILVDKYDDHQLKGSLRSLRALHVEHNKAGNWILVYKIHSG
NLELLTIDLVSTGSHDHTYRT

Download         Length: 306 bp

Antitoxin


Download         Length: 92 a.a.        Molecular weight: 10461.79 Da        Isoelectric Point: 4.8096

>AT272697 WP_021314843.1 NZ_CP118032:1065388-1065663 [Lactobacillus gasseri]
MTTTVSLRLPEDLKKQATDVFNEYGLDWSSAMRMILTQVVSENAIPVNLHRYSEISPSMKSNIDRSLQEYKAGNYKTTNS
VKELFEELDKD

Download         Length: 276 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A249NKC7

Antitoxin

Source ID Structure
AlphaFold DB A0A249NIV0

References