Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yoeB-Axe/YoeB-RelB
Location 693603..694117 Replicon chromosome
Accession NZ_CP118032
Organism Lactobacillus gasseri strain VSI47

Toxin (Protein)


Gene name yoeB Uniprot ID A0A845FJG3
Locus tag PUW43_RS03565 Protein ID WP_035422738.1
Coordinates 693603..693866 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID A0A833CFJ1
Locus tag PUW43_RS03570 Protein ID WP_035422737.1
Coordinates 693866..694117 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUW43_RS03515 (PUW43_03515) 689018..689317 + 300 WP_003656437.1 hypothetical protein -
PUW43_RS03520 (PUW43_03520) 689320..689556 + 237 WP_035422742.1 hypothetical protein -
PUW43_RS03525 (PUW43_03525) 689651..689968 + 318 WP_035422741.1 hypothetical protein -
PUW43_RS03530 (PUW43_03530) 689958..690245 + 288 WP_035422740.1 hypothetical protein -
PUW43_RS03535 (PUW43_03535) 690226..690483 + 258 WP_035422739.1 hypothetical protein -
PUW43_RS03540 (PUW43_03540) 690476..690838 + 363 WP_003656433.1 VRR-NUC domain-containing protein -
PUW43_RS03545 (PUW43_03545) 690835..691329 + 495 WP_003656430.1 hypothetical protein -
PUW43_RS03550 (PUW43_03550) 691420..691896 + 477 WP_003656428.1 ArpU family phage packaging/lysis transcriptional regulator -
PUW43_RS03555 (PUW43_03555) 692206..692718 + 513 WP_003656426.1 HNH endonuclease signature motif containing protein -
PUW43_RS03560 (PUW43_03560) 692861..693331 + 471 WP_003656424.1 phage terminase small subunit P27 family -
PUW43_RS03565 (PUW43_03565) 693603..693866 - 264 WP_035422738.1 Txe/YoeB family addiction module toxin Toxin
PUW43_RS03570 (PUW43_03570) 693866..694117 - 252 WP_035422737.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
PUW43_RS03575 (PUW43_03575) 694200..696080 + 1881 WP_035422736.1 terminase large subunit -
PUW43_RS03580 (PUW43_03580) 696061..696267 + 207 WP_080581164.1 DUF1056 family protein -
PUW43_RS03585 (PUW43_03585) 696267..697463 + 1197 WP_003656421.1 phage portal protein -
PUW43_RS03590 (PUW43_03590) 697423..698136 + 714 WP_003656418.1 Clp protease ClpP -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 672324..717644 45320


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

FCP1 homology domain

(4-73)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10631.85 Da        Isoelectric Point: 6.8794

>T272696 WP_035422738.1 NZ_CP118032:c693866-693603 [Lactobacillus gasseri]
MNVIWSDESWDDFEYWLDNDKRNVKKIRKLIKDTKRHPFDGIGKPEPLHDNLSGLWSRRITDEHRFVYYVENNSLYIVSA
RFHYSND

Download         Length: 264 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9474.53 Da        Isoelectric Point: 7.2004

>AT272696 WP_035422737.1 NZ_CP118032:c694117-693866 [Lactobacillus gasseri]
MQAEAYSNVRNNLKSFMKQVNDNSEAIIITSRNSEDNSVLISKADYDNLVENAYIRSSTANMDHILKSLKQLKNGKGKEH
NWE

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A845FJG3

Antitoxin

Source ID Structure
AlphaFold DB A0A833CFJ1

References