Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1477093..1477729 | Replicon | chromosome |
| Accession | NZ_CP118021 | ||
| Organism | Bacillus spizizenii strain B-354 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | PT671_RS07205 | Protein ID | WP_003156187.1 |
| Coordinates | 1477093..1477443 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | PT671_RS07210 | Protein ID | WP_003225183.1 |
| Coordinates | 1477448..1477729 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT671_RS07165 | 1472134..1472733 | - | 600 | WP_003225202.1 | phosphoserine phosphatase RsbX | - |
| PT671_RS07170 | 1472733..1473521 | - | 789 | WP_003225200.1 | RNA polymerase sigma factor SigB | - |
| PT671_RS07175 | 1473487..1473969 | - | 483 | WP_003225198.1 | anti-sigma B factor RsbW | - |
| PT671_RS07180 | 1473966..1474295 | - | 330 | WP_003225196.1 | anti-sigma factor antagonist RsbV | - |
| PT671_RS07185 | 1474357..1475364 | - | 1008 | WP_003225194.1 | phosphoserine phosphatase RsbU | - |
| PT671_RS07190 | 1475376..1475777 | - | 402 | WP_003225192.1 | serine/threonine-protein kinase RsbT | - |
| PT671_RS07195 | 1475781..1476146 | - | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| PT671_RS07200 | 1476151..1476975 | - | 825 | WP_003225186.1 | RsbT co-antagonist protein RsbRA | - |
| PT671_RS07205 | 1477093..1477443 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| PT671_RS07210 | 1477448..1477729 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| PT671_RS07215 | 1477845..1479014 | - | 1170 | WP_003225181.1 | alanine racemase | - |
| PT671_RS07220 | 1479129..1480145 | - | 1017 | WP_072181690.1 | outer membrane lipoprotein carrier protein LolA | - |
| PT671_RS07225 | 1480310..1480675 | - | 366 | WP_003225177.1 | holo-ACP synthase | - |
| PT671_RS07230 | 1480770..1481369 | + | 600 | WP_003225175.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T272694 WP_003156187.1 NZ_CP118021:c1477443-1477093 [Bacillus spizizenii]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|