Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 4930502..4931209 | Replicon | chromosome |
| Accession | NZ_CP118014 | ||
| Organism | Escherichia coli strain B-766 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | E0J2C8 |
| Locus tag | PT280_RS24095 | Protein ID | WP_000691790.1 |
| Coordinates | 4930502..4930843 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PT280_RS24100 | Protein ID | WP_000939438.1 |
| Coordinates | 4930874..4931209 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT280_RS24075 (4926491) | 4926491..4927756 | - | 1266 | WP_001218329.1 | integrase arm-type DNA-binding domain-containing protein | - |
| PT280_RS24080 (4928149) | 4928149..4929096 | - | 948 | WP_000342500.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| PT280_RS24085 (4929089) | 4929089..4929484 | - | 396 | WP_000152741.1 | DUF6088 family protein | - |
| PT280_RS24090 (4929554) | 4929554..4930387 | - | 834 | WP_001192746.1 | DUF4942 domain-containing protein | - |
| PT280_RS24095 (4930502) | 4930502..4930843 | - | 342 | WP_000691790.1 | TA system toxin CbtA family protein | Toxin |
| PT280_RS24100 (4930874) | 4930874..4931209 | - | 336 | WP_000939438.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PT280_RS24105 (4931209) | 4931209..4931682 | - | 474 | WP_001292742.1 | DNA repair protein RadC | - |
| PT280_RS24110 (4931712) | 4931712..4932530 | - | 819 | WP_000761991.1 | DUF932 domain-containing protein | - |
| PT280_RS24115 (4932766) | 4932766..4933719 | - | 954 | WP_000290405.1 | hypothetical protein | - |
| PT280_RS24120 (4934312) | 4934312..4934926 | + | 615 | WP_000772909.1 | inovirus Gp2 family protein | - |
| PT280_RS24125 (4935044) | 4935044..4935262 | + | 219 | WP_001064742.1 | AlpA family phage regulatory protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimC / fimI / fimA / fimE / fimB | 4897808..4947060 | 49252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13060.08 Da Isoelectric Point: 9.4583
>T272690 WP_000691790.1 NZ_CP118014:c4930843-4930502 [Escherichia coli]
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCYNTTAR
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCYNTTAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|