Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 4279451..4280288 | Replicon | chromosome |
Accession | NZ_CP118014 | ||
Organism | Escherichia coli strain B-766 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | PT280_RS20980 | Protein ID | WP_000227784.1 |
Coordinates | 4279746..4280288 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | PT280_RS20975 | Protein ID | WP_001297137.1 |
Coordinates | 4279451..4279762 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT280_RS20950 (4274471) | 4274471..4275418 | + | 948 | WP_001239440.1 | cytochrome o ubiquinol oxidase subunit II | - |
PT280_RS20955 (4275440) | 4275440..4277431 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
PT280_RS20960 (4277421) | 4277421..4278035 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
PT280_RS20965 (4278035) | 4278035..4278364 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
PT280_RS20970 (4278376) | 4278376..4279266 | + | 891 | WP_000971336.1 | heme o synthase | - |
PT280_RS20975 (4279451) | 4279451..4279762 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
PT280_RS20980 (4279746) | 4279746..4280288 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
PT280_RS20985 (4280344) | 4280344..4281268 | - | 925 | Protein_4067 | tetratricopeptide repeat protein | - |
PT280_RS20990 (4281676) | 4281676..4283040 | + | 1365 | WP_001000978.1 | MFS transporter | - |
PT280_RS20995 (4283168) | 4283168..4283659 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
PT280_RS21000 (4283827) | 4283827..4284738 | + | 912 | WP_000705849.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T272687 WP_000227784.1 NZ_CP118014:4279746-4280288 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|