Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4245374..4245992 | Replicon | chromosome |
Accession | NZ_CP118014 | ||
Organism | Escherichia coli strain B-766 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PT280_RS20810 | Protein ID | WP_001291435.1 |
Coordinates | 4245774..4245992 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PT280_RS20805 | Protein ID | WP_000344800.1 |
Coordinates | 4245374..4245748 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT280_RS20795 (4240445) | 4240445..4241638 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PT280_RS20800 (4241661) | 4241661..4244828 | + | 3168 | WP_274292398.1 | efflux RND transporter permease AcrB | - |
PT280_RS20805 (4245374) | 4245374..4245748 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PT280_RS20810 (4245774) | 4245774..4245992 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PT280_RS20815 (4246164) | 4246164..4246715 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
PT280_RS20820 (4246831) | 4246831..4247301 | + | 471 | WP_000136192.1 | YlaC family protein | - |
PT280_RS20825 (4247465) | 4247465..4249015 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PT280_RS20830 (4249057) | 4249057..4249410 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
PT280_RS20840 (4249789) | 4249789..4250100 | + | 312 | WP_000409911.1 | MGMT family protein | - |
PT280_RS20845 (4250131) | 4250131..4250703 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T272686 WP_001291435.1 NZ_CP118014:4245774-4245992 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT272686 WP_000344800.1 NZ_CP118014:4245374-4245748 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |