Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 3136745..3137383 | Replicon | chromosome |
| Accession | NZ_CP118014 | ||
| Organism | Escherichia coli strain B-766 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | PT280_RS15400 | Protein ID | WP_000813794.1 |
| Coordinates | 3137207..3137383 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PT280_RS15395 | Protein ID | WP_001270285.1 |
| Coordinates | 3136745..3137161 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT280_RS15375 (3131897) | 3131897..3132838 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| PT280_RS15380 (3132839) | 3132839..3133852 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| PT280_RS15385 (3133870) | 3133870..3135015 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| PT280_RS15390 (3135260) | 3135260..3136666 | - | 1407 | WP_000760589.1 | PLP-dependent aminotransferase family protein | - |
| PT280_RS15395 (3136745) | 3136745..3137161 | - | 417 | WP_001270285.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| PT280_RS15400 (3137207) | 3137207..3137383 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| PT280_RS15405 (3137605) | 3137605..3137835 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| PT280_RS15410 (3137927) | 3137927..3139888 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| PT280_RS15415 (3139961) | 3139961..3140497 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| PT280_RS15420 (3140550) | 3140550..3141764 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3141804..3142952 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T272685 WP_000813794.1 NZ_CP118014:c3137383-3137207 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15247.61 Da Isoelectric Point: 4.6115
>AT272685 WP_001270285.1 NZ_CP118014:c3137161-3136745 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|