Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1953967..1954592 | Replicon | chromosome |
Accession | NZ_CP118014 | ||
Organism | Escherichia coli strain B-766 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | PT280_RS09505 | Protein ID | WP_000911329.1 |
Coordinates | 1954194..1954592 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | PT280_RS09500 | Protein ID | WP_000450524.1 |
Coordinates | 1953967..1954194 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT280_RS09475 (1949769) | 1949769..1950239 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
PT280_RS09480 (1950239) | 1950239..1950811 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
PT280_RS09485 (1950957) | 1950957..1951835 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
PT280_RS09490 (1951852) | 1951852..1952886 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
PT280_RS09495 (1953099) | 1953099..1953812 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PT280_RS09500 (1953967) | 1953967..1954194 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PT280_RS09505 (1954194) | 1954194..1954592 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PT280_RS09510 (1954739) | 1954739..1955602 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
PT280_RS09515 (1955617) | 1955617..1957632 | + | 2016 | WP_000829294.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
PT280_RS09520 (1957706) | 1957706..1958404 | + | 699 | WP_000679823.1 | esterase | - |
PT280_RS09525 (1958485) | 1958485..1958685 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T272677 WP_000911329.1 NZ_CP118014:1954194-1954592 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |