Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 1936041..1936588 Replicon chromosome
Accession NZ_CP117994
Organism Vibrio alginolyticus strain 20220413_2

Toxin (Protein)


Gene name relE Uniprot ID A0A4P8FYK5
Locus tag PUT72_RS09095 Protein ID WP_005377013.1
Coordinates 1936041..1936343 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A4P8G149
Locus tag PUT72_RS09100 Protein ID WP_005377012.1
Coordinates 1936331..1936588 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUT72_RS09035 (PUT72_09035) 1931473..1931832 - 360 WP_079858402.1 aldehyde-activating protein -
PUT72_RS09040 (PUT72_09040) 1931863..1931991 - 129 WP_080358278.1 DUF3265 domain-containing protein -
PUT72_RS09045 (PUT72_09045) 1932531..1932989 - 459 WP_262645313.1 GNAT family N-acetyltransferase -
PUT72_RS09050 (PUT72_09050) 1933021..1933113 - 93 WP_080765011.1 DUF3265 domain-containing protein -
PUT72_RS09055 (PUT72_09055) 1933128..1933532 - 405 WP_262645312.1 hypothetical protein -
PUT72_RS09060 (PUT72_09060) 1933559..1933651 - 93 WP_017790380.1 DUF3265 domain-containing protein -
PUT72_RS09065 (PUT72_09065) 1933666..1934097 - 432 WP_005377056.1 DUF1851 domain-containing protein -
PUT72_RS09070 (PUT72_09070) 1934147..1934236 - 90 WP_213907488.1 DUF3265 domain-containing protein -
PUT72_RS09075 (PUT72_09075) 1934805..1935407 - 603 WP_157621963.1 hypothetical protein -
PUT72_RS09080 (PUT72_09080) 1935435..1935524 - 90 WP_080619587.1 DUF3265 domain-containing protein -
PUT72_RS09085 (PUT72_09085) 1935549..1935884 - 336 WP_206957870.1 TonB family protein -
PUT72_RS09090 (PUT72_09090) 1935913..1936005 - 93 WP_005377014.1 DUF3265 domain-containing protein -
PUT72_RS09095 (PUT72_09095) 1936041..1936343 - 303 WP_005377013.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PUT72_RS09100 (PUT72_09100) 1936331..1936588 - 258 WP_005377012.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PUT72_RS09105 (PUT72_09105) 1936670..1936819 - 150 WP_082245218.1 DUF3265 domain-containing protein -
PUT72_RS09110 (PUT72_09110) 1936788..1937195 - 408 WP_274342269.1 hypothetical protein -
PUT72_RS09115 (PUT72_09115) 1937669..1937754 - 86 Protein_1768 DUF3265 domain-containing protein -
PUT72_RS09120 (PUT72_09120) 1938126..1938215 - 90 WP_080100183.1 DUF3265 domain-containing protein -
PUT72_RS09125 (PUT72_09125) 1938380..1938703 - 324 WP_230855327.1 GNAT family N-acetyltransferase -
PUT72_RS09130 (PUT72_09130) 1938942..1939904 + 963 WP_017636093.1 integron integrase -
PUT72_RS09135 (PUT72_09135) 1939948..1940421 - 474 WP_054577705.1 DUF2947 domain-containing protein -
PUT72_RS09140 (PUT72_09140) 1940435..1941022 - 588 WP_005376917.1 HD domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1875576..1941022 65446
- inside Integron - - 1884060..1939904 55844


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11651.54 Da        Isoelectric Point: 5.1765

>T272668 WP_005377013.1 NZ_CP117994:c1936343-1936041 [Vibrio alginolyticus]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVIRAERDLRKFLLSKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9620.12 Da        Isoelectric Point: 6.7269

>AT272668 WP_005377012.1 NZ_CP117994:c1936588-1936331 [Vibrio alginolyticus]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVISHDEAKDKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P8FYK5

Antitoxin

Source ID Structure
AlphaFold DB A0A4P8G149

References