Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1914695..1915254 Replicon chromosome
Accession NZ_CP117994
Organism Vibrio alginolyticus strain 20220413_2

Toxin (Protein)


Gene name relE Uniprot ID A0A2I3C6F2
Locus tag PUT72_RS08845 Protein ID WP_005377065.1
Coordinates 1914976..1915254 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A2I3C6F3
Locus tag PUT72_RS08840 Protein ID WP_005487956.1
Coordinates 1914695..1914979 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUT72_RS08790 (PUT72_08790) 1909818..1909907 - 90 WP_071652537.1 DUF3265 domain-containing protein -
PUT72_RS08795 (PUT72_08795) 1909937..1910236 - 300 WP_005377019.1 hypothetical protein -
PUT72_RS08800 (PUT72_08800) 1910266..1910355 - 90 WP_074531724.1 DUF3265 domain-containing protein -
PUT72_RS08805 (PUT72_08805) 1910887..1910979 - 93 WP_080374080.1 DUF3265 domain-containing protein -
PUT72_RS08810 (PUT72_08810) 1911005..1911367 - 363 WP_005386966.1 VOC family protein -
PUT72_RS08815 (PUT72_08815) 1911465..1911549 - 85 Protein_1708 DUF3265 domain-containing protein -
PUT72_RS08820 (PUT72_08820) 1911968..1912077 - 110 Protein_1709 DUF3265 domain-containing protein -
PUT72_RS08825 (PUT72_08825) 1912637..1913758 - 1122 WP_053306504.1 hypothetical protein -
PUT72_RS08830 (PUT72_08830) 1913803..1913895 - 93 WP_077681052.1 DUF3265 domain-containing protein -
PUT72_RS08835 (PUT72_08835) 1913910..1914494 - 585 WP_238951996.1 hypothetical protein -
PUT72_RS08840 (PUT72_08840) 1914695..1914979 + 285 WP_005487956.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PUT72_RS08845 (PUT72_08845) 1914976..1915254 + 279 WP_005377065.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
PUT72_RS08850 (PUT72_08850) 1915283..1915360 - 78 WP_238952359.1 DUF3265 domain-containing protein -
PUT72_RS08855 (PUT72_08855) 1915506..1915688 + 183 WP_238951997.1 hypothetical protein -
PUT72_RS08860 (PUT72_08860) 1915769..1915858 - 90 WP_079767000.1 DUF3265 domain-containing protein -
PUT72_RS08865 (PUT72_08865) 1915876..1916154 - 279 WP_115386111.1 hypothetical protein -
PUT72_RS08870 (PUT72_08870) 1916245..1916337 - 93 WP_078513198.1 DUF3265 domain-containing protein -
PUT72_RS08875 (PUT72_08875) 1916352..1917380 - 1029 WP_213909735.1 DUF4238 domain-containing protein -
PUT72_RS08880 (PUT72_08880) 1917526..1918083 - 558 WP_182039726.1 nucleotidyltransferase family protein -
PUT72_RS08885 (PUT72_08885) 1918104..1918193 - 90 WP_171345239.1 DUF3265 domain-containing protein -
PUT72_RS08890 (PUT72_08890) 1918222..1918629 - 408 WP_171345237.1 hypothetical protein -
PUT72_RS08895 (PUT72_08895) 1918764..1919261 - 498 WP_029848292.1 GNAT family N-acetyltransferase -
PUT72_RS08900 (PUT72_08900) 1919288..1919380 - 93 WP_072935543.1 DUF3265 domain-containing protein -
PUT72_RS08905 (PUT72_08905) 1919395..1919895 - 501 WP_238951998.1 hypothetical protein -
PUT72_RS08910 (PUT72_08910) 1919922..1920050 - 129 WP_080996138.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1875576..1941022 65446
- inside Integron - - 1884060..1939904 55844


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-70)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10905.60 Da        Isoelectric Point: 4.3430

>T272667 WP_005377065.1 NZ_CP117994:1914976-1915254 [Vibrio alginolyticus]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIISYWVEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11082.40 Da        Isoelectric Point: 9.2167

>AT272667 WP_005487956.1 NZ_CP117994:1914695-1914979 [Vibrio alginolyticus]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQNAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I3C6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A2I3C6F3

References