Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1890241..1890769 | Replicon | chromosome |
| Accession | NZ_CP117994 | ||
| Organism | Vibrio alginolyticus strain 20220413_2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | K5TRR0 |
| Locus tag | PUT72_RS08545 | Protein ID | WP_005377002.1 |
| Coordinates | 1890479..1890769 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A347UR02 |
| Locus tag | PUT72_RS08540 | Protein ID | WP_005377003.1 |
| Coordinates | 1890241..1890489 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUT72_RS08485 (PUT72_08485) | 1885811..1886782 | - | 972 | WP_047102731.1 | phosphotransferase | - |
| PUT72_RS08490 (PUT72_08490) | 1886870..1886941 | - | 72 | Protein_1643 | DUF3265 domain-containing protein | - |
| PUT72_RS08495 (PUT72_08495) | 1887358..1887489 | - | 132 | WP_081007946.1 | DUF3265 domain-containing protein | - |
| PUT72_RS08500 (PUT72_08500) | 1887625..1887762 | - | 138 | WP_081007947.1 | DUF3265 domain-containing protein | - |
| PUT72_RS08505 (PUT72_08505) | 1888226..1888297 | - | 72 | Protein_1646 | DUF3265 domain-containing protein | - |
| PUT72_RS08510 (PUT72_08510) | 1888279..1888920 | - | 642 | WP_155486758.1 | hypothetical protein | - |
| PUT72_RS08515 (PUT72_08515) | 1888959..1889048 | - | 90 | WP_080100183.1 | DUF3265 domain-containing protein | - |
| PUT72_RS08520 (PUT72_08520) | 1889213..1889536 | - | 324 | WP_230855327.1 | GNAT family N-acetyltransferase | - |
| PUT72_RS08525 (PUT72_08525) | 1889568..1889660 | - | 93 | WP_118121208.1 | DUF3265 domain-containing protein | - |
| PUT72_RS08530 (PUT72_08530) | 1889796..1890053 | - | 258 | WP_238951964.1 | class I SAM-dependent methyltransferase | - |
| PUT72_RS08535 (PUT72_08535) | 1890098..1890166 | - | 69 | WP_074531725.1 | DUF3265 domain-containing protein | - |
| PUT72_RS08540 (PUT72_08540) | 1890241..1890489 | + | 249 | WP_005377003.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PUT72_RS08545 (PUT72_08545) | 1890479..1890769 | + | 291 | WP_005377002.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUT72_RS08550 (PUT72_08550) | 1890833..1890911 | - | 79 | Protein_1655 | DUF3265 domain-containing protein | - |
| PUT72_RS08555 (PUT72_08555) | 1891336..1891428 | - | 93 | WP_079858050.1 | DUF3265 domain-containing protein | - |
| PUT72_RS08560 (PUT72_08560) | 1891454..1891696 | - | 243 | WP_080765108.1 | zinc ribbon domain-containing protein | - |
| PUT72_RS08565 (PUT72_08565) | 1891829..1891921 | - | 93 | WP_196358505.1 | DUF3265 domain-containing protein | - |
| PUT72_RS08570 (PUT72_08570) | 1892340..1892633 | - | 294 | WP_054575586.1 | hypothetical protein | - |
| PUT72_RS08575 (PUT72_08575) | 1892732..1892824 | - | 93 | WP_081007977.1 | DUF3265 domain-containing protein | - |
| PUT72_RS08580 (PUT72_08580) | 1892839..1893471 | - | 633 | WP_054575587.1 | HEPN domain-containing protein | - |
| PUT72_RS08585 (PUT72_08585) | 1893655..1893897 | + | 243 | WP_053304443.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| PUT72_RS08590 (PUT72_08590) | 1893894..1894193 | + | 300 | WP_038940224.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PUT72_RS08595 (PUT72_08595) | 1894365..1894757 | + | 393 | WP_054575588.1 | hypothetical protein | - |
| PUT72_RS08600 (PUT72_08600) | 1894779..1894871 | - | 93 | WP_080256086.1 | DUF3265 domain-containing protein | - |
| PUT72_RS08605 (PUT72_08605) | 1894905..1895321 | - | 417 | WP_017821968.1 | lysozyme inhibitor LprI family protein | - |
| PUT72_RS08610 (PUT72_08610) | 1895351..1895440 | - | 90 | WP_213967281.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1875576..1941022 | 65446 | |
| - | inside | Integron | - | - | 1884060..1939904 | 55844 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11261.25 Da Isoelectric Point: 10.5932
>T272665 WP_005377002.1 NZ_CP117994:1890479-1890769 [Vibrio alginolyticus]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A347UR03 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A347UR02 |