Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1890241..1890769 Replicon chromosome
Accession NZ_CP117994
Organism Vibrio alginolyticus strain 20220413_2

Toxin (Protein)


Gene name relE Uniprot ID K5TRR0
Locus tag PUT72_RS08545 Protein ID WP_005377002.1
Coordinates 1890479..1890769 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR02
Locus tag PUT72_RS08540 Protein ID WP_005377003.1
Coordinates 1890241..1890489 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUT72_RS08485 (PUT72_08485) 1885811..1886782 - 972 WP_047102731.1 phosphotransferase -
PUT72_RS08490 (PUT72_08490) 1886870..1886941 - 72 Protein_1643 DUF3265 domain-containing protein -
PUT72_RS08495 (PUT72_08495) 1887358..1887489 - 132 WP_081007946.1 DUF3265 domain-containing protein -
PUT72_RS08500 (PUT72_08500) 1887625..1887762 - 138 WP_081007947.1 DUF3265 domain-containing protein -
PUT72_RS08505 (PUT72_08505) 1888226..1888297 - 72 Protein_1646 DUF3265 domain-containing protein -
PUT72_RS08510 (PUT72_08510) 1888279..1888920 - 642 WP_155486758.1 hypothetical protein -
PUT72_RS08515 (PUT72_08515) 1888959..1889048 - 90 WP_080100183.1 DUF3265 domain-containing protein -
PUT72_RS08520 (PUT72_08520) 1889213..1889536 - 324 WP_230855327.1 GNAT family N-acetyltransferase -
PUT72_RS08525 (PUT72_08525) 1889568..1889660 - 93 WP_118121208.1 DUF3265 domain-containing protein -
PUT72_RS08530 (PUT72_08530) 1889796..1890053 - 258 WP_238951964.1 class I SAM-dependent methyltransferase -
PUT72_RS08535 (PUT72_08535) 1890098..1890166 - 69 WP_074531725.1 DUF3265 domain-containing protein -
PUT72_RS08540 (PUT72_08540) 1890241..1890489 + 249 WP_005377003.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PUT72_RS08545 (PUT72_08545) 1890479..1890769 + 291 WP_005377002.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PUT72_RS08550 (PUT72_08550) 1890833..1890911 - 79 Protein_1655 DUF3265 domain-containing protein -
PUT72_RS08555 (PUT72_08555) 1891336..1891428 - 93 WP_079858050.1 DUF3265 domain-containing protein -
PUT72_RS08560 (PUT72_08560) 1891454..1891696 - 243 WP_080765108.1 zinc ribbon domain-containing protein -
PUT72_RS08565 (PUT72_08565) 1891829..1891921 - 93 WP_196358505.1 DUF3265 domain-containing protein -
PUT72_RS08570 (PUT72_08570) 1892340..1892633 - 294 WP_054575586.1 hypothetical protein -
PUT72_RS08575 (PUT72_08575) 1892732..1892824 - 93 WP_081007977.1 DUF3265 domain-containing protein -
PUT72_RS08580 (PUT72_08580) 1892839..1893471 - 633 WP_054575587.1 HEPN domain-containing protein -
PUT72_RS08585 (PUT72_08585) 1893655..1893897 + 243 WP_053304443.1 type II toxin-antitoxin system ParD family antitoxin -
PUT72_RS08590 (PUT72_08590) 1893894..1894193 + 300 WP_038940224.1 type II toxin-antitoxin system RelE/ParE family toxin -
PUT72_RS08595 (PUT72_08595) 1894365..1894757 + 393 WP_054575588.1 hypothetical protein -
PUT72_RS08600 (PUT72_08600) 1894779..1894871 - 93 WP_080256086.1 DUF3265 domain-containing protein -
PUT72_RS08605 (PUT72_08605) 1894905..1895321 - 417 WP_017821968.1 lysozyme inhibitor LprI family protein -
PUT72_RS08610 (PUT72_08610) 1895351..1895440 - 90 WP_213967281.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1875576..1941022 65446
- inside Integron - - 1884060..1939904 55844


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(12-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11261.25 Da        Isoelectric Point: 10.5932

>T272665 WP_005377002.1 NZ_CP117994:1890479-1890769 [Vibrio alginolyticus]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9079.37 Da        Isoelectric Point: 3.9610

>AT272665 WP_005377003.1 NZ_CP117994:1890241-1890489 [Vibrio alginolyticus]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR03

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR02

References