Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 4580208..4580824 | Replicon | chromosome |
| Accession | NZ_CP117993 | ||
| Organism | Enterobacter hormaechei isolate 1023017620-1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PUO93_RS22660 | Protein ID | WP_015569913.1 |
| Coordinates | 4580453..4580824 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | PUO93_RS22655 | Protein ID | WP_015569912.1 |
| Coordinates | 4580208..4580450 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUO93_RS22625 | 4575267..4576067 | + | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PUO93_RS22630 | 4576186..4576785 | + | 600 | WP_048246664.1 | glucose-1-phosphatase | - |
| PUO93_RS22635 | 4576779..4577660 | + | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| PUO93_RS22640 | 4577657..4578094 | + | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| PUO93_RS22645 | 4578139..4579080 | + | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| PUO93_RS22650 | 4579089..4580009 | - | 921 | WP_015569911.1 | alpha/beta hydrolase | - |
| PUO93_RS22655 | 4580208..4580450 | + | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| PUO93_RS22660 | 4580453..4580824 | + | 372 | WP_015569913.1 | PIN domain-containing protein | Toxin |
| PUO93_RS22665 | 4580864..4581793 | - | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| PUO93_RS22670 | 4581790..4582425 | - | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PUO93_RS22675 | 4582422..4583324 | - | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13767.90 Da Isoelectric Point: 6.4882
>T272664 WP_015569913.1 NZ_CP117993:4580453-4580824 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|