Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4386116..4386783 | Replicon | chromosome |
Accession | NZ_CP117993 | ||
Organism | Enterobacter hormaechei isolate 1023017620-1 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | E1IS66 |
Locus tag | PUO93_RS21725 | Protein ID | WP_000856973.1 |
Coordinates | 4386463..4386783 (+) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | E1IS67 |
Locus tag | PUO93_RS21720 | Protein ID | WP_000052843.1 |
Coordinates | 4386116..4386442 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUO93_RS21695 | 4381804..4382697 | + | 894 | WP_000033877.1 | 50S ribosome-binding GTPase | - |
PUO93_RS21700 | 4382889..4383578 | + | 690 | WP_274292324.1 | WYL domain-containing protein | - |
PUO93_RS21705 | 4383640..4384650 | + | 1011 | WP_001348677.1 | hypothetical protein | - |
PUO93_RS21710 | 4384743..4385564 | + | 822 | WP_213193600.1 | DUF932 domain-containing protein | - |
PUO93_RS21715 | 4385633..4386103 | + | 471 | WP_001275770.1 | DNA repair protein RadC | - |
PUO93_RS21720 | 4386116..4386442 | + | 327 | WP_000052843.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PUO93_RS21725 | 4386463..4386783 | + | 321 | WP_000856973.1 | TA system toxin CbtA family protein | Toxin |
PUO93_RS21730 | 4386918..4388753 | - | 1836 | WP_126850588.1 | P-loop NTPase fold protein | - |
PUO93_RS21735 | 4388768..4388956 | - | 189 | WP_075550043.1 | toxin-antitoxin system HicB family antitoxin | - |
PUO93_RS21740 | 4389093..4389434 | + | 342 | WP_015570064.1 | SymE family type I addiction module toxin | - |
PUO93_RS21745 | 4389485..4390522 | + | 1038 | WP_048246604.1 | RhuM family protein | - |
PUO93_RS21750 | 4390786..4391271 | + | 486 | WP_045338680.1 | type VI secretion system tube protein TssD | - |
PUO93_RS21755 | 4391281..4391646 | + | 366 | WP_023302859.1 | DUF2778 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | hcp/tssD | 4375325..4407733 | 32408 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12080.87 Da Isoelectric Point: 5.5873
>T272663 WP_000856973.1 NZ_CP117993:4386463-4386783 [Enterobacter hormaechei]
MKTQPATTPQAAKPCLSPLAVWQMLLTSLLDQHYGLTLNDTPFSDETVIQKHIEAGITLADAVNFLVERYELVRIDQKGF
SVQDQEPWLTSMDVHRARFKLNVERL
MKTQPATTPQAAKPCLSPLAVWQMLLTSLLDQHYGLTLNDTPFSDETVIQKHIEAGITLADAVNFLVERYELVRIDQKGF
SVQDQEPWLTSMDVHRARFKLNVERL
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A345ENE3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A345ENE4 |