Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 3851000..3851576 | Replicon | chromosome |
| Accession | NZ_CP117993 | ||
| Organism | Enterobacter hormaechei isolate 1023017620-1 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A800YKM1 |
| Locus tag | PUO93_RS19130 | Protein ID | WP_015572580.1 |
| Coordinates | 3851289..3851576 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A801DSF4 |
| Locus tag | PUO93_RS19125 | Protein ID | WP_017694570.1 |
| Coordinates | 3851000..3851302 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUO93_RS19105 | 3847291..3847836 | + | 546 | WP_006810254.1 | YfaZ family outer membrane protein | - |
| PUO93_RS19110 | 3848018..3849388 | - | 1371 | WP_017694568.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| PUO93_RS19115 | 3849542..3850294 | + | 753 | WP_015572582.1 | AraC family transcriptional regulator | - |
| PUO93_RS19120 | 3850333..3850971 | + | 639 | WP_017694569.1 | LysE family translocator | - |
| PUO93_RS19125 | 3851000..3851302 | - | 303 | WP_017694570.1 | BrnA antitoxin family protein | Antitoxin |
| PUO93_RS19130 | 3851289..3851576 | - | 288 | WP_015572580.1 | BrnT family toxin | Toxin |
| PUO93_RS19135 | 3851751..3853022 | + | 1272 | WP_017694571.1 | DUF445 domain-containing protein | - |
| PUO93_RS19140 | 3853019..3854095 | - | 1077 | WP_015572578.1 | DUF2955 domain-containing protein | - |
| PUO93_RS19145 | 3854085..3855152 | - | 1068 | WP_026094404.1 | HlyD family secretion protein | - |
| PUO93_RS19150 | 3855149..3855619 | - | 471 | WP_015572576.1 | MarR family transcriptional regulator | - |
| PUO93_RS19155 | 3855769..3856488 | - | 720 | WP_017694573.1 | winged helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11296.81 Da Isoelectric Point: 7.3587
>T272662 WP_015572580.1 NZ_CP117993:c3851576-3851289 [Enterobacter hormaechei]
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|