Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3366474..3367094 | Replicon | chromosome |
| Accession | NZ_CP117993 | ||
| Organism | Enterobacter hormaechei isolate 1023017620-1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A837FFM2 |
| Locus tag | PUO93_RS16865 | Protein ID | WP_015571250.1 |
| Coordinates | 3366876..3367094 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | F5RUW7 |
| Locus tag | PUO93_RS16860 | Protein ID | WP_006809850.1 |
| Coordinates | 3366474..3366848 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUO93_RS16850 | 3361601..3362794 | + | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PUO93_RS16855 | 3362817..3365963 | + | 3147 | WP_015571248.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| PUO93_RS16860 | 3366474..3366848 | + | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
| PUO93_RS16865 | 3366876..3367094 | + | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
| PUO93_RS16870 | 3367303..3367854 | + | 552 | WP_015571251.1 | maltose O-acetyltransferase | - |
| PUO93_RS16875 | 3367971..3368438 | + | 468 | WP_048247738.1 | YlaC family protein | - |
| PUO93_RS16880 | 3368410..3369870 | - | 1461 | WP_048247740.1 | PLP-dependent aminotransferase family protein | - |
| PUO93_RS16885 | 3369972..3370682 | + | 711 | WP_048247742.1 | GNAT family protein | - |
| PUO93_RS16890 | 3370679..3370819 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| PUO93_RS16895 | 3370822..3371082 | - | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T272661 WP_015571250.1 NZ_CP117993:3366876-3367094 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT272661 WP_006809850.1 NZ_CP117993:3366474-3366848 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FFM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FGN8 |