Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 2739482..2740279 | Replicon | chromosome |
| Accession | NZ_CP117993 | ||
| Organism | Enterobacter hormaechei isolate 1023017620-1 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | PUO93_RS13790 | Protein ID | WP_040117472.1 |
| Coordinates | 2739482..2740003 (-) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | F5RT92 |
| Locus tag | PUO93_RS13795 | Protein ID | WP_001303459.1 |
| Coordinates | 2740010..2740279 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUO93_RS13760 | 2735080..2735769 | + | 690 | WP_040117478.1 | pyrimidine utilization protein B | - |
| PUO93_RS13765 | 2735781..2736167 | + | 387 | WP_040117477.1 | pyrimidine utilization protein C | - |
| PUO93_RS13770 | 2736175..2736975 | + | 801 | WP_047735077.1 | pyrimidine utilization protein D | - |
| PUO93_RS13775 | 2736985..2737575 | + | 591 | WP_040117475.1 | malonic semialdehyde reductase | - |
| PUO93_RS13780 | 2737588..2738079 | + | 492 | WP_040117474.1 | pyrimidine utilization flavin reductase protein F | - |
| PUO93_RS13785 | 2738101..2739423 | + | 1323 | WP_040117473.1 | pyrimidine utilization transport protein G | - |
| PUO93_RS13790 | 2739482..2740003 | - | 522 | WP_040117472.1 | GNAT family N-acetyltransferase | Toxin |
| PUO93_RS13795 | 2740010..2740279 | - | 270 | WP_001303459.1 | DUF1778 domain-containing protein | Antitoxin |
| PUO93_RS13800 | 2740353..2741258 | - | 906 | WP_017693666.1 | DMT family transporter | - |
| PUO93_RS13805 | 2741375..2741545 | - | 171 | WP_001273664.1 | general stress protein | - |
| PUO93_RS13810 | 2741937..2742533 | + | 597 | WP_006809323.1 | NAD(P)H:quinone oxidoreductase | - |
| PUO93_RS13815 | 2742552..2742779 | + | 228 | WP_006809324.1 | YccJ family protein | - |
| PUO93_RS13820 | 2742812..2744053 | - | 1242 | WP_017693667.1 | bifunctional glucose-1-phosphatase/inositol phosphatase | - |
| PUO93_RS13825 | 2744206..2744301 | + | 96 | Protein_2556 | transcriptional regulator | - |
| PUO93_RS13830 | 2744380..2744739 | - | 360 | WP_017384779.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19437.18 Da Isoelectric Point: 7.4317
>T272660 WP_040117472.1 NZ_CP117993:c2740003-2739482 [Enterobacter hormaechei]
VANLTIEMLSEGTDYDFGDFDCGEPSLNAFLTDHLVRQHGGRILRGYLLKERDHPRILGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAVHKELQGNEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKLGFIPLAGENSSSLF
FPTQSIERLFEQA
VANLTIEMLSEGTDYDFGDFDCGEPSLNAFLTDHLVRQHGGRILRGYLLKERDHPRILGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAVHKELQGNEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKLGFIPLAGENSSSLF
FPTQSIERLFEQA
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|