Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2172423..2173162 | Replicon | chromosome |
| Accession | NZ_CP117993 | ||
| Organism | Enterobacter hormaechei isolate 1023017620-1 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
| Locus tag | PUO93_RS11040 | Protein ID | WP_003857133.1 |
| Coordinates | 2172677..2173162 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | PUO93_RS11035 | Protein ID | WP_003857131.1 |
| Coordinates | 2172423..2172689 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUO93_RS11015 | 2167915..2168901 | + | 987 | WP_047637343.1 | DUF979 domain-containing protein | - |
| PUO93_RS11020 | 2168911..2169906 | + | 996 | WP_048247348.1 | DUF2891 domain-containing protein | - |
| PUO93_RS11025 | 2169929..2171311 | - | 1383 | WP_045911739.1 | MFS transporter | - |
| PUO93_RS11030 | 2171441..2172359 | + | 919 | Protein_2003 | LysR family transcriptional regulator | - |
| PUO93_RS11035 | 2172423..2172689 | + | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| PUO93_RS11040 | 2172677..2173162 | + | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
| PUO93_RS11045 | 2173343..2173671 | + | 329 | Protein_2006 | ISNCY family transposase | - |
| PUO93_RS11050 | 2174100..2174546 | + | 447 | WP_014069654.1 | DUF3290 domain-containing protein | - |
| PUO93_RS11055 | 2174556..2175191 | + | 636 | WP_015570517.1 | DUF421 domain-containing protein | - |
| PUO93_RS11060 | 2175375..2175989 | - | 615 | WP_080337332.1 | NUDIX hydrolase | - |
| PUO93_RS11065 | 2175989..2177281 | - | 1293 | WP_048247370.1 | glycosyl hydrolase family 28 protein | - |
| PUO93_RS11070 | 2177386..2178144 | - | 759 | WP_015570520.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T272659 WP_003857133.1 NZ_CP117993:2172677-2173162 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3L9PBP9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FCR9 |