Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 1560918..1561446 | Replicon | chromosome |
Accession | NZ_CP117988 | ||
Organism | Vibrio campbellii strain 20220413_1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | K5TRR0 |
Locus tag | PUN50_RS07500 | Protein ID | WP_005377002.1 |
Coordinates | 1560918..1561208 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A347UR02 |
Locus tag | PUN50_RS07505 | Protein ID | WP_005377003.1 |
Coordinates | 1561198..1561446 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUN50_RS07450 (PUN50_07450) | 1556196..1557164 | - | 969 | WP_274291124.1 | IS30-like element ISVa6 family transposase | - |
PUN50_RS07455 (PUN50_07455) | 1557281..1557370 | + | 90 | WP_072615037.1 | DUF3265 domain-containing protein | - |
PUN50_RS07460 (PUN50_07460) | 1557404..1558087 | + | 684 | WP_274291125.1 | hypothetical protein | - |
PUN50_RS07465 (PUN50_07465) | 1558102..1558194 | + | 93 | WP_079749976.1 | DUF3265 domain-containing protein | - |
PUN50_RS07470 (PUN50_07470) | 1558549..1559517 | - | 969 | WP_274291116.1 | IS30-like element ISVa6 family transposase | - |
PUN50_RS07475 (PUN50_07475) | 1559631..1559723 | + | 93 | WP_140138444.1 | DUF3265 domain-containing protein | - |
PUN50_RS07480 (PUN50_07480) | 1559762..1560268 | + | 507 | WP_274291126.1 | hypothetical protein | - |
PUN50_RS07485 (PUN50_07485) | 1560283..1560375 | + | 93 | WP_081235044.1 | DUF3265 domain-containing protein | - |
PUN50_RS07490 (PUN50_07490) | 1560403..1560783 | + | 381 | WP_122019783.1 | DUF4087 domain-containing protein | - |
PUN50_RS07495 (PUN50_07495) | 1560810..1560899 | + | 90 | WP_206384589.1 | DUF3265 domain-containing protein | - |
PUN50_RS07500 (PUN50_07500) | 1560918..1561208 | - | 291 | WP_005377002.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUN50_RS07505 (PUN50_07505) | 1561198..1561446 | - | 249 | WP_005377003.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PUN50_RS07510 (PUN50_07510) | 1561521..1561589 | + | 69 | WP_074531725.1 | DUF3265 domain-containing protein | - |
PUN50_RS07515 (PUN50_07515) | 1561676..1562458 | + | 783 | WP_274291127.1 | toll/interleukin-1 receptor domain-containing protein | - |
PUN50_RS07520 (PUN50_07520) | 1562493..1563461 | - | 969 | WP_274291116.1 | IS30-like element ISVa6 family transposase | - |
PUN50_RS07525 (PUN50_07525) | 1563575..1563667 | + | 93 | WP_196298605.1 | DUF3265 domain-containing protein | - |
PUN50_RS07530 (PUN50_07530) | 1564486..1564953 | + | 468 | WP_274291128.1 | hypothetical protein | - |
PUN50_RS07535 (PUN50_07535) | 1565491..1565583 | + | 93 | WP_274291129.1 | DUF3265 domain-containing protein | - |
PUN50_RS07540 (PUN50_07540) | 1565605..1565868 | + | 264 | WP_258472328.1 | hypothetical protein | - |
PUN50_RS07545 (PUN50_07545) | 1566012..1566365 | + | 354 | WP_005433784.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1525174..1572433 | 47259 | |
- | inside | IScluster/Tn | - | - | 1552301..1563269 | 10968 | |
- | inside | Integron | - | - | 1523973..1566365 | 42392 | |
- | inside | Genomic island | - | - | 1525662..1566365 | 40703 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11261.25 Da Isoelectric Point: 10.5932
>T272651 WP_005377002.1 NZ_CP117988:c1561208-1560918 [Vibrio campbellii]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A347UR03 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A347UR02 |