Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1560918..1561446 Replicon chromosome
Accession NZ_CP117988
Organism Vibrio campbellii strain 20220413_1

Toxin (Protein)


Gene name relE Uniprot ID K5TRR0
Locus tag PUN50_RS07500 Protein ID WP_005377002.1
Coordinates 1560918..1561208 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR02
Locus tag PUN50_RS07505 Protein ID WP_005377003.1
Coordinates 1561198..1561446 (-) Length 83 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUN50_RS07450 (PUN50_07450) 1556196..1557164 - 969 WP_274291124.1 IS30-like element ISVa6 family transposase -
PUN50_RS07455 (PUN50_07455) 1557281..1557370 + 90 WP_072615037.1 DUF3265 domain-containing protein -
PUN50_RS07460 (PUN50_07460) 1557404..1558087 + 684 WP_274291125.1 hypothetical protein -
PUN50_RS07465 (PUN50_07465) 1558102..1558194 + 93 WP_079749976.1 DUF3265 domain-containing protein -
PUN50_RS07470 (PUN50_07470) 1558549..1559517 - 969 WP_274291116.1 IS30-like element ISVa6 family transposase -
PUN50_RS07475 (PUN50_07475) 1559631..1559723 + 93 WP_140138444.1 DUF3265 domain-containing protein -
PUN50_RS07480 (PUN50_07480) 1559762..1560268 + 507 WP_274291126.1 hypothetical protein -
PUN50_RS07485 (PUN50_07485) 1560283..1560375 + 93 WP_081235044.1 DUF3265 domain-containing protein -
PUN50_RS07490 (PUN50_07490) 1560403..1560783 + 381 WP_122019783.1 DUF4087 domain-containing protein -
PUN50_RS07495 (PUN50_07495) 1560810..1560899 + 90 WP_206384589.1 DUF3265 domain-containing protein -
PUN50_RS07500 (PUN50_07500) 1560918..1561208 - 291 WP_005377002.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PUN50_RS07505 (PUN50_07505) 1561198..1561446 - 249 WP_005377003.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PUN50_RS07510 (PUN50_07510) 1561521..1561589 + 69 WP_074531725.1 DUF3265 domain-containing protein -
PUN50_RS07515 (PUN50_07515) 1561676..1562458 + 783 WP_274291127.1 toll/interleukin-1 receptor domain-containing protein -
PUN50_RS07520 (PUN50_07520) 1562493..1563461 - 969 WP_274291116.1 IS30-like element ISVa6 family transposase -
PUN50_RS07525 (PUN50_07525) 1563575..1563667 + 93 WP_196298605.1 DUF3265 domain-containing protein -
PUN50_RS07530 (PUN50_07530) 1564486..1564953 + 468 WP_274291128.1 hypothetical protein -
PUN50_RS07535 (PUN50_07535) 1565491..1565583 + 93 WP_274291129.1 DUF3265 domain-containing protein -
PUN50_RS07540 (PUN50_07540) 1565605..1565868 + 264 WP_258472328.1 hypothetical protein -
PUN50_RS07545 (PUN50_07545) 1566012..1566365 + 354 WP_005433784.1 hypothetical protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1525174..1572433 47259
- inside IScluster/Tn - - 1552301..1563269 10968
- inside Integron - - 1523973..1566365 42392
- inside Genomic island - - 1525662..1566365 40703


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 97 a.a.        Molecular weight: 11261.25 Da        Isoelectric Point: 10.5932

>T272651 WP_005377002.1 NZ_CP117988:c1561208-1560918 [Vibrio campbellii]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD

Download         Length: 291 bp


Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9079.37 Da        Isoelectric Point: 3.9610

>AT272651 WP_005377003.1 NZ_CP117988:c1561446-1561198 [Vibrio campbellii]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Download         Length: 249 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A347UR03


Antitoxin

Source ID Structure
AlphaFold DB A0A347UR02

References