272650

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 1555309..1556075 Replicon chromosome
Accession NZ_CP117988
Organism Vibrio campbellii strain 20220413_1

Toxin (Protein)


Gene name - Uniprot ID A0A3Q0L5V0
Locus tag PUN50_RS07440 Protein ID WP_011080392.1
Coordinates 1555309..1555806 (-) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A3N3DV16
Locus tag PUN50_RS07445 Protein ID WP_013571703.1
Coordinates 1555803..1556075 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUN50_RS07395 (PUN50_07395) 1550876..1551091 + 216 WP_239937538.1 DUF6434 domain-containing protein -
PUN50_RS07400 (PUN50_07400) 1551170..1551262 + 93 WP_263214687.1 DUF3265 domain-containing protein -
PUN50_RS07405 (PUN50_07405) 1551593..1551871 + 279 WP_274291122.1 hypothetical protein -
PUN50_RS07410 (PUN50_07410) 1551996..1552211 + 216 WP_239937538.1 DUF6434 domain-containing protein -
PUN50_RS07415 (PUN50_07415) 1552301..1553269 - 969 WP_274291116.1 IS30-like element ISVa6 family transposase -
PUN50_RS07420 (PUN50_07420) 1553383..1553475 + 93 WP_263214687.1 DUF3265 domain-containing protein -
PUN50_RS07425 (PUN50_07425) 1553503..1553994 + 492 WP_017191311.1 hypothetical protein -
PUN50_RS07430 (PUN50_07430) 1554129..1554575 + 447 WP_274291123.1 effector binding domain-containing protein -
PUN50_RS07435 (PUN50_07435) 1554731..1555186 + 456 WP_103412994.1 GNAT family N-acetyltransferase -
PUN50_RS07440 (PUN50_07440) 1555309..1555806 - 498 WP_011080392.1 GNAT family N-acetyltransferase Toxin
PUN50_RS07445 (PUN50_07445) 1555803..1556075 - 273 WP_013571703.1 DUF1778 domain-containing protein Antitoxin
PUN50_RS07450 (PUN50_07450) 1556196..1557164 - 969 WP_274291124.1 IS30-like element ISVa6 family transposase -
PUN50_RS07455 (PUN50_07455) 1557281..1557370 + 90 WP_072615037.1 DUF3265 domain-containing protein -
PUN50_RS07460 (PUN50_07460) 1557404..1558087 + 684 WP_274291125.1 hypothetical protein -
PUN50_RS07465 (PUN50_07465) 1558102..1558194 + 93 WP_079749976.1 DUF3265 domain-containing protein -
PUN50_RS07470 (PUN50_07470) 1558549..1559517 - 969 WP_274291116.1 IS30-like element ISVa6 family transposase -
PUN50_RS07475 (PUN50_07475) 1559631..1559723 + 93 WP_140138444.1 DUF3265 domain-containing protein -
PUN50_RS07480 (PUN50_07480) 1559762..1560268 + 507 WP_274291126.1 hypothetical protein -
PUN50_RS07485 (PUN50_07485) 1560283..1560375 + 93 WP_081235044.1 DUF3265 domain-containing protein -
PUN50_RS07490 (PUN50_07490) 1560403..1560783 + 381 WP_122019783.1 DUF4087 domain-containing protein -
PUN50_RS07495 (PUN50_07495) 1560810..1560899 + 90 WP_206384589.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1525174..1572433 47259
- inside IScluster/Tn - - 1552301..1563269 10968
- inside Integron - - 1523973..1566365 42392
- inside Genomic island - - 1525662..1566365 40703


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18486.13 Da        Isoelectric Point: 8.0487

>T272650 WP_011080392.1 NZ_CP117988:c1555806-1555309 [Vibrio campbellii]
MMNTVLLDKAKHDRNRFNCGIEALNNYLKVMASQQAKKDNTRTFVLEDDNDNSHVIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFEDAENKLFITIADV
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9747.28 Da        Isoelectric Point: 8.5960

>AT272650 WP_013571703.1 NZ_CP117988:c1556075-1555803 [Vibrio campbellii]
MATTLPRITARVDVDTQDLLTKAAAIAGMSSINSFVLSAAIEKAKQVIEREQALKLSQADAMLLMEALDRPATQNSKLKA
AADRYESKIQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3Q0L5V0

Antitoxin

Source ID Structure
AlphaFold DB A0A3N3DV16

References