272649

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1541785..1542344 Replicon chromosome
Accession NZ_CP117988
Organism Vibrio campbellii strain 20220413_1

Toxin (Protein)


Gene name relE Uniprot ID A0A2I3C6F2
Locus tag PUN50_RS07285 Protein ID WP_005377065.1
Coordinates 1541785..1542063 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PUN50_RS07290 Protein ID WP_051118409.1
Coordinates 1542060..1542344 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUN50_RS07215 (PUN50_07215) 1536872..1536964 + 93 WP_140391838.1 DUF3265 domain-containing protein -
PUN50_RS07220 (PUN50_07220) 1536997..1537773 + 777 WP_274291111.1 DUF4393 domain-containing protein -
PUN50_RS07225 (PUN50_07225) 1537788..1537880 + 93 WP_078534682.1 DUF3265 domain-containing protein -
PUN50_RS07230 (PUN50_07230) 1537934..1538239 + 306 WP_274291112.1 NIPSNAP family protein -
PUN50_RS07235 (PUN50_07235) 1538388..1538714 + 327 WP_274291113.1 hypothetical protein -
PUN50_RS07240 (PUN50_07240) 1538701..1538787 + 87 Protein_1352 DUF3265 domain-containing protein -
PUN50_RS07245 (PUN50_07245) 1538861..1539220 + 360 WP_047482898.1 hypothetical protein -
PUN50_RS07250 (PUN50_07250) 1539217..1539282 + 66 Protein_1354 DUF3265 domain-containing protein -
PUN50_RS07255 (PUN50_07255) 1539372..1539713 + 342 WP_182053875.1 hypothetical protein -
PUN50_RS07260 (PUN50_07260) 1539695..1539778 + 84 Protein_1356 DUF3265 domain-containing protein -
PUN50_RS07265 (PUN50_07265) 1539944..1540147 + 204 WP_274291114.1 hypothetical protein -
PUN50_RS07270 (PUN50_07270) 1540250..1540966 + 717 WP_274291115.1 hypothetical protein -
PUN50_RS07275 (PUN50_07275) 1541116..1541643 + 528 WP_043883630.1 CbrC family protein -
PUN50_RS07280 (PUN50_07280) 1541607..1541756 + 150 WP_005433746.1 DUF3265 domain-containing protein -
PUN50_RS07285 (PUN50_07285) 1541785..1542063 - 279 WP_005377065.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
PUN50_RS07290 (PUN50_07290) 1542060..1542344 - 285 WP_051118409.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PUN50_RS07295 (PUN50_07295) 1542530..1542850 + 321 WP_050906161.1 immunity protein Tsi6 family protein -
PUN50_RS07300 (PUN50_07300) 1542876..1543844 - 969 WP_274291116.1 IS30-like element ISVa6 family transposase -
PUN50_RS07305 (PUN50_07305) 1543925..1543996 + 72 Protein_1365 DUF3265 domain-containing protein -
PUN50_RS07310 (PUN50_07310) 1544097..1545239 + 1143 WP_274291117.1 DUF4263 domain-containing protein -
PUN50_RS07315 (PUN50_07315) 1545356..1545637 + 282 WP_274291118.1 hypothetical protein -
PUN50_RS07320 (PUN50_07320) 1545675..1545764 + 90 WP_140101462.1 DUF3265 domain-containing protein -
PUN50_RS07325 (PUN50_07325) 1545792..1546280 + 489 WP_053441821.1 GNAT family N-acetyltransferase -
PUN50_RS07330 (PUN50_07330) 1546298..1546387 + 90 WP_274291240.1 DUF3265 domain-containing protein -
PUN50_RS07335 (PUN50_07335) 1546416..1546715 + 300 WP_038892926.1 hypothetical protein -
PUN50_RS07340 (PUN50_07340) 1546745..1546834 + 90 WP_077345960.1 DUF3265 domain-containing protein -
PUN50_RS07345 (PUN50_07345) 1546872..1547327 + 456 WP_274291119.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1525174..1572433 47259
- flank IS/Tn - - 1542876..1543652 776
- inside Integron - - 1523973..1566365 42392
- inside Genomic island - - 1525662..1566365 40703


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-74)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10905.60 Da        Isoelectric Point: 4.3430

>T272649 WP_005377065.1 NZ_CP117988:c1542063-1541785 [Vibrio campbellii]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIISYWVEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11081.41 Da        Isoelectric Point: 10.0201

>AT272649 WP_051118409.1 NZ_CP117988:c1542344-1542060 [Vibrio campbellii]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHNAWLTEQVNLAFEKFDSGKSVFVEHQNAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I3C6F2

Antitoxin

Source ID Structure

References