272648

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1533083..1533611 Replicon chromosome
Accession NZ_CP117988
Organism Vibrio campbellii strain 20220413_1

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PUN50_RS07175 Protein ID WP_274291101.1
Coordinates 1533083..1533373 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR02
Locus tag PUN50_RS07180 Protein ID WP_005377003.1
Coordinates 1533363..1533611 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUN50_RS07115 (PUN50_07115) 1528574..1529032 + 459 WP_274291105.1 HPP family protein -
PUN50_RS07120 (PUN50_07120) 1529602..1529690 + 89 Protein_1328 DUF3265 domain-containing protein -
PUN50_RS07125 (PUN50_07125) 1529728..1530168 + 441 WP_077200541.1 hypothetical protein -
PUN50_RS07130 (PUN50_07130) 1530301..1530780 + 480 WP_274291106.1 hypothetical protein -
PUN50_RS07135 (PUN50_07135) 1530806..1530895 + 90 WP_072609598.1 DUF3265 domain-containing protein -
PUN50_RS07140 (PUN50_07140) 1530929..1531510 + 582 WP_039839640.1 hypothetical protein -
PUN50_RS07145 (PUN50_07145) 1531525..1531617 + 93 WP_080765254.1 DUF3265 domain-containing protein -
PUN50_RS07150 (PUN50_07150) 1531654..1532235 + 582 WP_274291107.1 DJ-1/PfpI family protein -
PUN50_RS07155 (PUN50_07155) 1532258..1532350 + 93 WP_005494820.1 DUF3265 domain-containing protein -
PUN50_RS07160 (PUN50_07160) 1532369..1532659 - 291 WP_274291101.1 type II toxin-antitoxin system RelE/ParE family toxin -
PUN50_RS07165 (PUN50_07165) 1532649..1532897 - 249 WP_005377003.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
PUN50_RS07170 (PUN50_07170) 1532972..1533040 + 69 WP_074531725.1 DUF3265 domain-containing protein -
PUN50_RS07175 (PUN50_07175) 1533083..1533373 - 291 WP_274291101.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PUN50_RS07180 (PUN50_07180) 1533363..1533611 - 249 WP_005377003.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PUN50_RS07185 (PUN50_07185) 1533686..1533754 + 69 WP_074531725.1 DUF3265 domain-containing protein -
PUN50_RS07190 (PUN50_07190) 1533936..1534886 + 951 WP_274291108.1 AAA family ATPase -
PUN50_RS07195 (PUN50_07195) 1534895..1535308 + 414 WP_274291109.1 hypothetical protein -
PUN50_RS07200 (PUN50_07200) 1535328..1535420 + 93 WP_274291110.1 DUF3265 domain-containing protein -
PUN50_RS07205 (PUN50_07205) 1535462..1536367 + 906 WP_172572386.1 hypothetical protein -
PUN50_RS07210 (PUN50_07210) 1536508..1536849 + 342 WP_009696098.1 hypothetical protein -
PUN50_RS07215 (PUN50_07215) 1536872..1536964 + 93 WP_140391838.1 DUF3265 domain-containing protein -
PUN50_RS07220 (PUN50_07220) 1536997..1537773 + 777 WP_274291111.1 DUF4393 domain-containing protein -
PUN50_RS07225 (PUN50_07225) 1537788..1537880 + 93 WP_078534682.1 DUF3265 domain-containing protein -
PUN50_RS07230 (PUN50_07230) 1537934..1538239 + 306 WP_274291112.1 NIPSNAP family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1525174..1572433 47259
- inside Integron - - 1523973..1566365 42392
- inside Genomic island - - 1525662..1566365 40703


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(12-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11260.27 Da        Isoelectric Point: 10.6832

>T272648 WP_274291101.1 NZ_CP117988:c1533373-1533083 [Vibrio campbellii]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSNVYRKAMKRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9079.37 Da        Isoelectric Point: 3.9610

>AT272648 WP_005377003.1 NZ_CP117988:c1533611-1533363 [Vibrio campbellii]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR02

References