Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1532369..1532897 | Replicon | chromosome |
| Accession | NZ_CP117988 | ||
| Organism | Vibrio campbellii strain 20220413_1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PUN50_RS07160 | Protein ID | WP_274291101.1 |
| Coordinates | 1532369..1532659 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A347UR02 |
| Locus tag | PUN50_RS07165 | Protein ID | WP_005377003.1 |
| Coordinates | 1532649..1532897 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUN50_RS07100 (PUN50_07100) | 1527452..1527805 | + | 354 | WP_237304809.1 | glyoxalase/bleomycin resistance/dioxygenase family protein | - |
| PUN50_RS07105 (PUN50_07105) | 1527823..1527912 | + | 90 | WP_274291239.1 | DUF3265 domain-containing protein | - |
| PUN50_RS07110 (PUN50_07110) | 1527920..1528471 | - | 552 | WP_274291104.1 | TetR/AcrR family transcriptional regulator | - |
| PUN50_RS07115 (PUN50_07115) | 1528574..1529032 | + | 459 | WP_274291105.1 | HPP family protein | - |
| PUN50_RS07120 (PUN50_07120) | 1529602..1529690 | + | 89 | Protein_1328 | DUF3265 domain-containing protein | - |
| PUN50_RS07125 (PUN50_07125) | 1529728..1530168 | + | 441 | WP_077200541.1 | hypothetical protein | - |
| PUN50_RS07130 (PUN50_07130) | 1530301..1530780 | + | 480 | WP_274291106.1 | hypothetical protein | - |
| PUN50_RS07135 (PUN50_07135) | 1530806..1530895 | + | 90 | WP_072609598.1 | DUF3265 domain-containing protein | - |
| PUN50_RS07140 (PUN50_07140) | 1530929..1531510 | + | 582 | WP_039839640.1 | hypothetical protein | - |
| PUN50_RS07145 (PUN50_07145) | 1531525..1531617 | + | 93 | WP_080765254.1 | DUF3265 domain-containing protein | - |
| PUN50_RS07150 (PUN50_07150) | 1531654..1532235 | + | 582 | WP_274291107.1 | DJ-1/PfpI family protein | - |
| PUN50_RS07155 (PUN50_07155) | 1532258..1532350 | + | 93 | WP_005494820.1 | DUF3265 domain-containing protein | - |
| PUN50_RS07160 (PUN50_07160) | 1532369..1532659 | - | 291 | WP_274291101.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUN50_RS07165 (PUN50_07165) | 1532649..1532897 | - | 249 | WP_005377003.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PUN50_RS07170 (PUN50_07170) | 1532972..1533040 | + | 69 | WP_074531725.1 | DUF3265 domain-containing protein | - |
| PUN50_RS07175 (PUN50_07175) | 1533083..1533373 | - | 291 | WP_274291101.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PUN50_RS07180 (PUN50_07180) | 1533363..1533611 | - | 249 | WP_005377003.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| PUN50_RS07185 (PUN50_07185) | 1533686..1533754 | + | 69 | WP_074531725.1 | DUF3265 domain-containing protein | - |
| PUN50_RS07190 (PUN50_07190) | 1533936..1534886 | + | 951 | WP_274291108.1 | AAA family ATPase | - |
| PUN50_RS07195 (PUN50_07195) | 1534895..1535308 | + | 414 | WP_274291109.1 | hypothetical protein | - |
| PUN50_RS07200 (PUN50_07200) | 1535328..1535420 | + | 93 | WP_274291110.1 | DUF3265 domain-containing protein | - |
| PUN50_RS07205 (PUN50_07205) | 1535462..1536367 | + | 906 | WP_172572386.1 | hypothetical protein | - |
| PUN50_RS07210 (PUN50_07210) | 1536508..1536849 | + | 342 | WP_009696098.1 | hypothetical protein | - |
| PUN50_RS07215 (PUN50_07215) | 1536872..1536964 | + | 93 | WP_140391838.1 | DUF3265 domain-containing protein | - |
| PUN50_RS07220 (PUN50_07220) | 1536997..1537773 | + | 777 | WP_274291111.1 | DUF4393 domain-containing protein | - |
| PUN50_RS07225 (PUN50_07225) | 1537788..1537880 | + | 93 | WP_078534682.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1525174..1572433 | 47259 | |
| - | inside | Integron | - | - | 1523973..1566365 | 42392 | |
| - | inside | Genomic island | - | - | 1525662..1566365 | 40703 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11260.27 Da Isoelectric Point: 10.6832
>T272647 WP_274291101.1 NZ_CP117988:c1532659-1532369 [Vibrio campbellii]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSNVYRKAMKRLDD
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSNVYRKAMKRLDD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|