272646

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1525662..1526190 Replicon chromosome
Accession NZ_CP117988
Organism Vibrio campbellii strain 20220413_1

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PUN50_RS07065 Protein ID WP_274291101.1
Coordinates 1525662..1525952 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR02
Locus tag PUN50_RS07070 Protein ID WP_005377003.1
Coordinates 1525942..1526190 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUN50_RS07040 (PUN50_07040) 1522255..1522839 + 585 WP_010649586.1 ribosomal protein S5-alanine N-acetyltransferase -
PUN50_RS07045 (PUN50_07045) 1522840..1523427 + 588 WP_274291098.1 HD domain-containing protein -
PUN50_RS07050 (PUN50_07050) 1523441..1523914 + 474 WP_005434054.1 DUF2947 domain-containing protein -
PUN50_RS07055 (PUN50_07055) 1523973..1524935 - 963 WP_274291099.1 integron integrase -
PUN50_RS07060 (PUN50_07060) 1525174..1525524 + 351 WP_274291100.1 RidA family protein -
PUN50_RS07065 (PUN50_07065) 1525662..1525952 - 291 WP_274291101.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PUN50_RS07070 (PUN50_07070) 1525942..1526190 - 249 WP_005377003.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PUN50_RS07075 (PUN50_07075) 1526265..1526333 + 69 WP_074531725.1 DUF3265 domain-containing protein -
PUN50_RS07080 (PUN50_07080) 1526385..1526720 + 336 WP_274291102.1 5-carboxymethyl-2-hydroxymuconate isomerase -
PUN50_RS07085 (PUN50_07085) 1526741..1526833 + 93 WP_005530753.1 DUF3265 domain-containing protein -
PUN50_RS07090 (PUN50_07090) 1526864..1527310 + 447 WP_274291103.1 hypothetical protein -
PUN50_RS07095 (PUN50_07095) 1527334..1527423 + 90 WP_077201254.1 DUF3265 domain-containing protein -
PUN50_RS07100 (PUN50_07100) 1527452..1527805 + 354 WP_237304809.1 glyoxalase/bleomycin resistance/dioxygenase family protein -
PUN50_RS07105 (PUN50_07105) 1527823..1527912 + 90 WP_274291239.1 DUF3265 domain-containing protein -
PUN50_RS07110 (PUN50_07110) 1527920..1528471 - 552 WP_274291104.1 TetR/AcrR family transcriptional regulator -
PUN50_RS07115 (PUN50_07115) 1528574..1529032 + 459 WP_274291105.1 HPP family protein -
PUN50_RS07120 (PUN50_07120) 1529602..1529690 + 89 Protein_1328 DUF3265 domain-containing protein -
PUN50_RS07125 (PUN50_07125) 1529728..1530168 + 441 WP_077200541.1 hypothetical protein -
PUN50_RS07130 (PUN50_07130) 1530301..1530780 + 480 WP_274291106.1 hypothetical protein -
PUN50_RS07135 (PUN50_07135) 1530806..1530895 + 90 WP_072609598.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1525174..1572433 47259
- inside Integron - - 1523973..1566365 42392
- inside Genomic island - - 1525662..1566365 40703


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(12-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11260.27 Da        Isoelectric Point: 10.6832

>T272646 WP_274291101.1 NZ_CP117988:c1525952-1525662 [Vibrio campbellii]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSNVYRKAMKRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9079.37 Da        Isoelectric Point: 3.9610

>AT272646 WP_005377003.1 NZ_CP117988:c1526190-1525942 [Vibrio campbellii]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR02

References