Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1525662..1526190 | Replicon | chromosome |
| Accession | NZ_CP117988 | ||
| Organism | Vibrio campbellii strain 20220413_1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PUN50_RS07065 | Protein ID | WP_274291101.1 |
| Coordinates | 1525662..1525952 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A347UR02 |
| Locus tag | PUN50_RS07070 | Protein ID | WP_005377003.1 |
| Coordinates | 1525942..1526190 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUN50_RS07040 (PUN50_07040) | 1522255..1522839 | + | 585 | WP_010649586.1 | ribosomal protein S5-alanine N-acetyltransferase | - |
| PUN50_RS07045 (PUN50_07045) | 1522840..1523427 | + | 588 | WP_274291098.1 | HD domain-containing protein | - |
| PUN50_RS07050 (PUN50_07050) | 1523441..1523914 | + | 474 | WP_005434054.1 | DUF2947 domain-containing protein | - |
| PUN50_RS07055 (PUN50_07055) | 1523973..1524935 | - | 963 | WP_274291099.1 | integron integrase | - |
| PUN50_RS07060 (PUN50_07060) | 1525174..1525524 | + | 351 | WP_274291100.1 | RidA family protein | - |
| PUN50_RS07065 (PUN50_07065) | 1525662..1525952 | - | 291 | WP_274291101.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUN50_RS07070 (PUN50_07070) | 1525942..1526190 | - | 249 | WP_005377003.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PUN50_RS07075 (PUN50_07075) | 1526265..1526333 | + | 69 | WP_074531725.1 | DUF3265 domain-containing protein | - |
| PUN50_RS07080 (PUN50_07080) | 1526385..1526720 | + | 336 | WP_274291102.1 | 5-carboxymethyl-2-hydroxymuconate isomerase | - |
| PUN50_RS07085 (PUN50_07085) | 1526741..1526833 | + | 93 | WP_005530753.1 | DUF3265 domain-containing protein | - |
| PUN50_RS07090 (PUN50_07090) | 1526864..1527310 | + | 447 | WP_274291103.1 | hypothetical protein | - |
| PUN50_RS07095 (PUN50_07095) | 1527334..1527423 | + | 90 | WP_077201254.1 | DUF3265 domain-containing protein | - |
| PUN50_RS07100 (PUN50_07100) | 1527452..1527805 | + | 354 | WP_237304809.1 | glyoxalase/bleomycin resistance/dioxygenase family protein | - |
| PUN50_RS07105 (PUN50_07105) | 1527823..1527912 | + | 90 | WP_274291239.1 | DUF3265 domain-containing protein | - |
| PUN50_RS07110 (PUN50_07110) | 1527920..1528471 | - | 552 | WP_274291104.1 | TetR/AcrR family transcriptional regulator | - |
| PUN50_RS07115 (PUN50_07115) | 1528574..1529032 | + | 459 | WP_274291105.1 | HPP family protein | - |
| PUN50_RS07120 (PUN50_07120) | 1529602..1529690 | + | 89 | Protein_1328 | DUF3265 domain-containing protein | - |
| PUN50_RS07125 (PUN50_07125) | 1529728..1530168 | + | 441 | WP_077200541.1 | hypothetical protein | - |
| PUN50_RS07130 (PUN50_07130) | 1530301..1530780 | + | 480 | WP_274291106.1 | hypothetical protein | - |
| PUN50_RS07135 (PUN50_07135) | 1530806..1530895 | + | 90 | WP_072609598.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1525174..1572433 | 47259 | |
| - | inside | Integron | - | - | 1523973..1566365 | 42392 | |
| - | inside | Genomic island | - | - | 1525662..1566365 | 40703 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11260.27 Da Isoelectric Point: 10.6832
>T272646 WP_274291101.1 NZ_CP117988:c1525952-1525662 [Vibrio campbellii]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSNVYRKAMKRLDD
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSNVYRKAMKRLDD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|