Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 733143..733906 | Replicon | chromosome |
Accession | NZ_CP117988 | ||
Organism | Vibrio campbellii strain 20220413_1 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | PUN50_RS03465 | Protein ID | WP_274290872.1 |
Coordinates | 733143..733649 (-) | Length | 169 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | PUN50_RS03470 | Protein ID | WP_000212004.1 |
Coordinates | 733640..733906 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUN50_RS03425 (PUN50_03425) | 728217..728495 | - | 279 | WP_000058216.1 | helix-turn-helix transcriptional regulator | - |
PUN50_RS03430 (PUN50_03430) | 728492..728815 | - | 324 | WP_001896384.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
PUN50_RS03435 (PUN50_03435) | 728996..729277 | + | 282 | WP_000433891.1 | type IV conjugative transfer system protein TraL | - |
PUN50_RS03440 (PUN50_03440) | 729274..729900 | + | 627 | WP_274290870.1 | TraE/TraK family type IV conjugative transfer system protein | - |
PUN50_RS03445 (PUN50_03445) | 729884..730780 | + | 897 | WP_274291235.1 | type-F conjugative transfer system secretin TraK | - |
PUN50_RS03450 (PUN50_03450) | 730783..732072 | + | 1290 | WP_274290871.1 | TraB/VirB10 family protein | - |
PUN50_RS03455 (PUN50_03455) | 732147..732719 | + | 573 | WP_024008834.1 | type IV conjugative transfer system lipoprotein TraV | - |
PUN50_RS03460 (PUN50_03460) | 732716..733102 | + | 387 | WP_023584042.1 | TraA family conjugative transfer protein | - |
PUN50_RS03465 (PUN50_03465) | 733143..733649 | - | 507 | WP_274290872.1 | GNAT family N-acetyltransferase | Toxin |
PUN50_RS03470 (PUN50_03470) | 733640..733906 | - | 267 | WP_000212004.1 | DUF1778 domain-containing protein | Antitoxin |
PUN50_RS03475 (PUN50_03475) | 734275..734967 | + | 693 | WP_274290873.1 | DsbC family protein | - |
PUN50_RS03480 (PUN50_03480) | 734967..737366 | + | 2400 | WP_193284099.1 | type IV secretion system protein TraC | - |
PUN50_RS03485 (PUN50_03485) | 737359..737706 | + | 348 | WP_015066569.1 | hypothetical protein | - |
PUN50_RS03490 (PUN50_03490) | 737690..738202 | + | 513 | WP_258519357.1 | S26 family signal peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 704190..774713 | 70523 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 169 a.a. Molecular weight: 18308.03 Da Isoelectric Point: 7.2132
>T272645 WP_274290872.1 NZ_CP117988:c733649-733143 [Vibrio campbellii]
MGISAPTLLTDEHQLNAFQCGIEELDTWLRKQALKSQKRGTTRVYVVNDTDAHQVVGYYAIAMGSVSREQAFSSLRRNSP
DPIPMVILARLGVDNAYQGQGIAAGLLKDCIIRSVQAMNAVGGAGILVHAIDGSAQTFYKKFGFKESTFDPLVLMARICD
IEKSLSID
MGISAPTLLTDEHQLNAFQCGIEELDTWLRKQALKSQKRGTTRVYVVNDTDAHQVVGYYAIAMGSVSREQAFSSLRRNSP
DPIPMVILARLGVDNAYQGQGIAAGLLKDCIIRSVQAMNAVGGAGILVHAIDGSAQTFYKKFGFKESTFDPLVLMARICD
IEKSLSID
Download Length: 507 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|