Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 2275329..2276105 | Replicon | chromosome |
Accession | NZ_CP117979 | ||
Organism | Staphylococcus aureus strain B-41012 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | PT798_RS10930 | Protein ID | WP_000031108.1 |
Coordinates | 2275329..2275481 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | PT798_RS10935 | Protein ID | WP_001251230.1 |
Coordinates | 2275506..2276105 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT798_RS10915 | 2271417..2272238 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
PT798_RS10920 | 2272690..2274075 | - | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
PT798_RS10925 | 2274271..2274666 | - | 396 | WP_000901023.1 | hypothetical protein | - |
PT798_RS10930 | 2275329..2275481 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
PT798_RS10935 | 2275506..2276105 | - | 600 | WP_001251230.1 | hypothetical protein | Antitoxin |
PT798_RS10940 | 2276264..2276734 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
PT798_RS10945 | 2276739..2277866 | - | 1128 | WP_031590038.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
PT798_RS10950 | 2278017..2278739 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
PT798_RS10955 | 2278732..2280189 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T272640 WP_000031108.1 NZ_CP117979:c2275481-2275329 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22369.51 Da Isoelectric Point: 4.9728
>AT272640 WP_001251230.1 NZ_CP117979:c2276105-2275506 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKYAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKYAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|