Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 45336..45861 Replicon plasmid unnamed1
Accession NZ_CP117977
Organism Salmonella enterica strain B-4212

Toxin (Protein)


Gene name ccdB Uniprot ID Q9EUE9
Locus tag PT747_RS23585 Protein ID WP_001541545.1
Coordinates 45336..45641 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag PT747_RS23590 Protein ID WP_000813641.1
Coordinates 45643..45861 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT747_RS23545 40738..41282 - 545 Protein_46 inverse autotransporter beta domain-containing protein -
PT747_RS23550 41177..41500 - 324 WP_223557582.1 LysM peptidoglycan-binding domain-containing protein -
PT747_RS23555 42017..42502 - 486 WP_000905606.1 membrane protein -
PT747_RS23560 42496..42921 - 426 WP_001134680.1 CaiF/GrlA family transcriptional regulator -
PT747_RS23565 43149..43700 - 552 WP_000545754.1 EAL domain-containing protein -
PT747_RS23570 43709..44491 - 783 WP_000082169.1 site-specific integrase -
PT747_RS23575 44526..45047 - 522 WP_000198608.1 hypothetical protein -
PT747_RS23580 45044..45334 - 291 WP_001266176.1 hypothetical protein -
PT747_RS23585 45336..45641 - 306 WP_001541545.1 type II toxin-antitoxin system toxin CcdB Toxin
PT747_RS23590 45643..45861 - 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PT747_RS23595 46537..47058 + 522 WP_080147800.1 hypothetical protein -
PT747_RS23600 47102..47530 - 429 Protein_57 hypothetical protein -
PT747_RS23605 47542..47837 + 296 Protein_58 cytoplasmic protein -
PT747_RS23610 48331..49320 + 990 WP_000461383.1 RepB family plasmid replication initiator protein -
PT747_RS23615 49651..49770 - 120 Protein_60 recombinase -
PT747_RS23620 49823..50209 - 387 WP_001541549.1 YgiW/YdeI family stress tolerance OB fold protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - pefB / pefA / pefC / pefD / spvB / spvC / pefB / pefA / pefC / pefD 1..60499 60499


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11659.54 Da        Isoelectric Point: 5.8604

>T272634 WP_001541545.1 NZ_CP117977:c45641-45336 [Salmonella enterica]
MQFKVYTCKRESRYRLFVDVQSDIIDTPERRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT272634 WP_000813641.1 NZ_CP117977:c45861-45643 [Salmonella enterica]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q9EUE9

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References