Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 12715..13340 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP117977 | ||
| Organism | Salmonella enterica strain B-4212 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PT747_RS23400 | Protein ID | WP_000911322.1 |
| Coordinates | 12942..13340 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8F2UQ48 |
| Locus tag | PT747_RS23395 | Protein ID | WP_000450263.1 |
| Coordinates | 12715..12942 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT747_RS23365 | 7980..8149 | - | 170 | Protein_10 | phospholipase | - |
| PT747_RS23370 | 8200..8397 | - | 198 | WP_223155440.1 | hypothetical protein | - |
| PT747_RS23375 | 8371..8644 | - | 274 | Protein_12 | disulfide bond formation protein DsbA | - |
| PT747_RS23380 | 8761..9324 | - | 564 | WP_000139307.1 | fertility inhibition protein FinO | - |
| PT747_RS23385 | 9379..10119 | - | 741 | WP_000177630.1 | conjugal transfer pilus acetylase TraX | - |
| PT747_RS23390 | 10139..12633 | - | 2495 | Protein_15 | MobF family relaxase | - |
| PT747_RS23395 | 12715..12942 | + | 228 | WP_000450263.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PT747_RS23400 | 12942..13340 | + | 399 | WP_000911322.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PT747_RS23405 | 13349..15565 | - | 2217 | WP_137075843.1 | type IV conjugative transfer system coupling protein TraD | - |
| PT747_RS23410 | 15937..16668 | - | 732 | WP_001541558.1 | conjugal transfer complement resistance protein TraT | - |
| PT747_RS23415 | 16971..17213 | - | 243 | WP_024131413.1 | hypothetical protein | - |
| PT747_RS23420 | 17210..17911 | - | 702 | WP_148201696.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pefB / pefA / pefC / pefD / spvB / spvC / pefB / pefA / pefC / pefD | 1..60499 | 60499 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14887.13 Da Isoelectric Point: 8.5264
>T272633 WP_000911322.1 NZ_CP117977:12942-13340 [Salmonella enterica]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVGGLRTEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVGGLRTEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|