Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 12715..13340 Replicon plasmid unnamed1
Accession NZ_CP117977
Organism Salmonella enterica strain B-4212

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PT747_RS23400 Protein ID WP_000911322.1
Coordinates 12942..13340 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8F2UQ48
Locus tag PT747_RS23395 Protein ID WP_000450263.1
Coordinates 12715..12942 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT747_RS23365 7980..8149 - 170 Protein_10 phospholipase -
PT747_RS23370 8200..8397 - 198 WP_223155440.1 hypothetical protein -
PT747_RS23375 8371..8644 - 274 Protein_12 disulfide bond formation protein DsbA -
PT747_RS23380 8761..9324 - 564 WP_000139307.1 fertility inhibition protein FinO -
PT747_RS23385 9379..10119 - 741 WP_000177630.1 conjugal transfer pilus acetylase TraX -
PT747_RS23390 10139..12633 - 2495 Protein_15 MobF family relaxase -
PT747_RS23395 12715..12942 + 228 WP_000450263.1 toxin-antitoxin system antitoxin VapB Antitoxin
PT747_RS23400 12942..13340 + 399 WP_000911322.1 type II toxin-antitoxin system VapC family toxin Toxin
PT747_RS23405 13349..15565 - 2217 WP_137075843.1 type IV conjugative transfer system coupling protein TraD -
PT747_RS23410 15937..16668 - 732 WP_001541558.1 conjugal transfer complement resistance protein TraT -
PT747_RS23415 16971..17213 - 243 WP_024131413.1 hypothetical protein -
PT747_RS23420 17210..17911 - 702 WP_148201696.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - pefB / pefA / pefC / pefD / spvB / spvC / pefB / pefA / pefC / pefD 1..60499 60499


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(7-51)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14887.13 Da        Isoelectric Point: 8.5264

>T272633 WP_000911322.1 NZ_CP117977:12942-13340 [Salmonella enterica]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVGGLRTEDWS

Download         Length: 399 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8532.53 Da        Isoelectric Point: 4.7513

>AT272633 WP_000450263.1 NZ_CP117977:12715-12942 [Salmonella enterica]
METSVFLSNRSQAVRLPKAVALPEHVKRVEVIAVGRTRIITPAGESWDEWFDGNNVSADFMDNREQPSVQERESF

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References