Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4361687..4362347 | Replicon | chromosome |
| Accession | NZ_CP117976 | ||
| Organism | Salmonella enterica strain B-4212 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q57K70 |
| Locus tag | PT747_RS21240 | Protein ID | WP_000244756.1 |
| Coordinates | 4361687..4362100 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | PT747_RS21245 | Protein ID | WP_000351186.1 |
| Coordinates | 4362081..4362347 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT747_RS21220 (4357628) | 4357628..4359361 | - | 1734 | WP_000813392.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PT747_RS21225 (4359367) | 4359367..4360080 | - | 714 | WP_001540860.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PT747_RS21230 (4360104) | 4360104..4361000 | - | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| PT747_RS21235 (4361113) | 4361113..4361634 | + | 522 | WP_001055885.1 | flavodoxin FldB | - |
| PT747_RS21240 (4361687) | 4361687..4362100 | - | 414 | WP_000244756.1 | protein YgfX | Toxin |
| PT747_RS21245 (4362081) | 4362081..4362347 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| PT747_RS21250 (4362597) | 4362597..4363577 | + | 981 | WP_000874173.1 | tRNA-modifying protein YgfZ | - |
| PT747_RS21255 (4363693) | 4363693..4364352 | - | 660 | WP_023235227.1 | hemolysin III family protein | - |
| PT747_RS21260 (4364516) | 4364516..4364827 | - | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
| PT747_RS21265 (4364985) | 4364985..4366418 | + | 1434 | WP_001230139.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T272632 WP_000244756.1 NZ_CP117976:c4362100-4361687 [Salmonella enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |