Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4350802..4351427 | Replicon | chromosome |
| Accession | NZ_CP117976 | ||
| Organism | Salmonella enterica strain B-4212 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PT747_RS21175 | Protein ID | WP_000911337.1 |
| Coordinates | 4350802..4351200 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | C0PXM4 |
| Locus tag | PT747_RS21180 | Protein ID | WP_000557545.1 |
| Coordinates | 4351200..4351427 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT747_RS21160 (4347478) | 4347478..4348062 | - | 585 | WP_001244638.1 | fimbrial protein | - |
| PT747_RS21165 (4348781) | 4348781..4349413 | - | 633 | WP_001540855.1 | YfdX family protein | - |
| PT747_RS21170 (4349460) | 4349460..4349996 | - | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
| PT747_RS21175 (4350802) | 4350802..4351200 | - | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PT747_RS21180 (4351200) | 4351200..4351427 | - | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PT747_RS21185 (4351636) | 4351636..4351887 | + | 252 | WP_001540858.1 | hypothetical protein | - |
| PT747_RS21190 (4352162) | 4352162..4352969 | + | 808 | Protein_4129 | DUF1460 domain-containing protein | - |
| PT747_RS21200 (4353254) | 4353254..4354012 | - | 759 | WP_000244328.1 | amidase activator ActS | - |
| PT747_RS21205 (4354277) | 4354277..4354822 | + | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| PT747_RS21210 (4354898) | 4354898..4356415 | - | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4342405..4352969 | 10564 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T272631 WP_000911337.1 NZ_CP117976:c4351200-4350802 [Salmonella enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|