Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4196783..4197597 | Replicon | chromosome |
Accession | NZ_CP117976 | ||
Organism | Salmonella enterica strain B-4212 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | PT747_RS20470 | Protein ID | WP_000971655.1 |
Coordinates | 4197070..4197597 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | PT747_RS20465 | Protein ID | WP_000855694.1 |
Coordinates | 4196783..4197073 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT747_RS20445 (4192676) | 4192676..4194364 | - | 1689 | WP_001540787.1 | type III secretion system outer membrane ring protein InvG | - |
PT747_RS20450 (4194361) | 4194361..4195011 | - | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
PT747_RS20455 (4195467) | 4195467..4195910 | + | 444 | WP_000715102.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
PT747_RS20460 (4196328) | 4196328..4196513 | + | 186 | Protein_3986 | IS3 family transposase | - |
PT747_RS20465 (4196783) | 4196783..4197073 | + | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
PT747_RS20470 (4197070) | 4197070..4197597 | + | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
PT747_RS20475 (4197670) | 4197670..4197885 | - | 216 | Protein_3989 | IS5/IS1182 family transposase | - |
PT747_RS20480 (4198223) | 4198223..4198879 | + | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
PT747_RS20485 (4199124) | 4199124..4199618 | - | 495 | WP_001540790.1 | hypothetical protein | - |
PT747_RS20490 (4199645) | 4199645..4200313 | - | 669 | WP_001540791.1 | hypothetical protein | - |
PT747_RS20495 (4200470) | 4200470..4200709 | - | 240 | Protein_3993 | hypothetical protein | - |
PT747_RS20500 (4200900) | 4200900..4201298 | - | 399 | Protein_3994 | cytoplasmic protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4197670..4197810 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T272630 WP_000971655.1 NZ_CP117976:4197070-4197597 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |