Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1770444..1771064 | Replicon | chromosome |
Accession | NZ_CP117976 | ||
Organism | Salmonella enterica strain B-4212 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PT747_RS08320 | Protein ID | WP_001280991.1 |
Coordinates | 1770444..1770662 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PT747_RS08325 | Protein ID | WP_000344807.1 |
Coordinates | 1770690..1771064 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT747_RS08280 (1765808) | 1765808..1766377 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
PT747_RS08285 (1766410) | 1766410..1766799 | - | 390 | WP_000961285.1 | MGMT family protein | - |
PT747_RS08295 (1767030) | 1767030..1768439 | - | 1410 | WP_038393950.1 | EAL domain-containing protein | - |
PT747_RS08300 (1768664) | 1768664..1768924 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PT747_RS08305 (1768930) | 1768930..1769070 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PT747_RS08310 (1769126) | 1769126..1769596 | - | 471 | WP_000136183.1 | YlaC family protein | - |
PT747_RS08315 (1769714) | 1769714..1770265 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
PT747_RS08320 (1770444) | 1770444..1770662 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PT747_RS08325 (1770690) | 1770690..1771064 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PT747_RS08330 (1771560) | 1771560..1774709 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PT747_RS08335 (1774732) | 1774732..1775925 | - | 1194 | WP_023235518.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T272624 WP_001280991.1 NZ_CP117976:c1770662-1770444 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT272624 WP_000344807.1 NZ_CP117976:c1771064-1770690 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|