Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1010591..1011107 | Replicon | chromosome |
| Accession | NZ_CP117976 | ||
| Organism | Salmonella enterica strain B-4212 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | PT747_RS04655 | Protein ID | WP_000220578.1 |
| Coordinates | 1010823..1011107 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PT747_RS04650 | Protein ID | WP_000212724.1 |
| Coordinates | 1010591..1010833 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT747_RS04630 (1005591) | 1005591..1006724 | + | 1134 | WP_000459940.1 | amidohydrolase/deacetylase family metallohydrolase | - |
| PT747_RS04635 (1006708) | 1006708..1007826 | + | 1119 | WP_001139177.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PT747_RS04640 (1007823) | 1007823..1008563 | + | 741 | WP_000779257.1 | KDGP aldolase family protein | - |
| PT747_RS04645 (1008580) | 1008580..1010513 | + | 1934 | Protein_893 | BglG family transcription antiterminator | - |
| PT747_RS04650 (1010591) | 1010591..1010833 | + | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PT747_RS04655 (1010823) | 1010823..1011107 | + | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PT747_RS04660 (1011111) | 1011111..1011575 | - | 465 | WP_001009177.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PT747_RS04665 (1011792) | 1011792..1013930 | - | 2139 | WP_001541406.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PT747_RS04670 (1014339) | 1014339..1015987 | - | 1649 | Protein_898 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T272621 WP_000220578.1 NZ_CP117976:1010823-1011107 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |