Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 197163..197923 | Replicon | chromosome |
| Accession | NZ_CP117976 | ||
| Organism | Salmonella enterica strain B-4212 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | Q57IH1 |
| Locus tag | PT747_RS00830 | Protein ID | WP_000533909.1 |
| Coordinates | 197163..197648 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | M7RHS4 |
| Locus tag | PT747_RS00835 | Protein ID | WP_000965886.1 |
| Coordinates | 197636..197923 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT747_RS00805 (192825) | 192825..193535 | - | 711 | WP_001541097.1 | DUF3053 domain-containing protein | - |
| PT747_RS00810 (193974) | 193974..194264 | + | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
| PT747_RS00815 (194552) | 194552..194764 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| PT747_RS00820 (194938) | 194938..195477 | + | 540 | WP_000047148.1 | copper-binding periplasmic metallochaperone CueP | - |
| PT747_RS00825 (195729) | 195729..196984 | + | 1256 | WP_110301500.1 | IS3-like element ISSen1 family transposase | - |
| PT747_RS00830 (197163) | 197163..197648 | - | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
| PT747_RS00835 (197636) | 197636..197923 | - | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
| PT747_RS00840 (198101) | 198101..198568 | - | 468 | WP_000702450.1 | GNAT family N-acetyltransferase | - |
| PT747_RS00845 (198740) | 198740..199141 | - | 402 | Protein_166 | IS3 family transposase | - |
| PT747_RS00850 (199403) | 199403..201472 | - | 2070 | WP_001291737.1 | glycine--tRNA ligase subunit beta | - |
| PT747_RS00855 (201482) | 201482..202393 | - | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
| PT747_RS00860 (202532) | 202532..202834 | - | 303 | WP_000605590.1 | YsaB family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T272619 WP_000533909.1 NZ_CP117976:c197648-197163 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7F36 | |
| PDB | 7AK8 | |
| PDB | 5FVJ |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK8 | |
| AlphaFold DB | A0A3V2JDX2 |