Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 6819433..6820019 | Replicon | chromosome |
Accession | NZ_CP117974 | ||
Organism | Pseudomonas aeruginosa strain B-3509 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | PT746_RS32320 | Protein ID | WP_003120987.1 |
Coordinates | 6819433..6819732 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PT746_RS32325 | Protein ID | WP_003448662.1 |
Coordinates | 6819729..6820019 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT746_RS32300 | 6814546..6815079 | - | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
PT746_RS32305 | 6815069..6816394 | - | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
PT746_RS32310 | 6816398..6818107 | - | 1710 | WP_012076860.1 | PilN family type IVB pilus formation outer membrane protein | - |
PT746_RS32315 | 6818107..6819231 | - | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
PT746_RS32320 | 6819433..6819732 | + | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PT746_RS32325 | 6819729..6820019 | + | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
PT746_RS32330 | 6820090..6820434 | - | 345 | WP_016851612.1 | hypothetical protein | - |
PT746_RS32335 | 6820575..6822551 | - | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
PT746_RS32340 | 6822548..6824437 | - | 1890 | WP_016851610.1 | hypothetical protein | - |
PT746_RS32345 | 6824659..6824868 | - | 210 | WP_003105733.1 | cold-shock protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T272616 WP_003120987.1 NZ_CP117974:6819433-6819732 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|