Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 5393463..5393968 | Replicon | chromosome |
| Accession | NZ_CP117974 | ||
| Organism | Pseudomonas aeruginosa strain B-3509 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A069QL22 |
| Locus tag | PT746_RS25660 | Protein ID | WP_003121619.1 |
| Coordinates | 5393687..5393968 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q9I707 |
| Locus tag | PT746_RS25655 | Protein ID | WP_003112628.1 |
| Coordinates | 5393463..5393690 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT746_RS25630 | 5388481..5389974 | + | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
| PT746_RS25635 | 5390143..5391570 | + | 1428 | WP_003083784.1 | GABA permease | - |
| PT746_RS25640 | 5391652..5391993 | - | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| PT746_RS25645 | 5392066..5392566 | - | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| PT746_RS25650 | 5392667..5393287 | + | 621 | WP_003101226.1 | hypothetical protein | - |
| PT746_RS25655 | 5393463..5393690 | + | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PT746_RS25660 | 5393687..5393968 | + | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| PT746_RS25665 | 5394268..5395176 | + | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| PT746_RS25670 | 5395208..5395618 | - | 411 | WP_003101225.1 | aegerolysin family protein | - |
| PT746_RS25675 | 5395798..5396532 | - | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| PT746_RS25680 | 5396633..5397319 | - | 687 | WP_004351997.1 | FadR/GntR family transcriptional regulator | - |
| PT746_RS25685 | 5397368..5398717 | - | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T272614 WP_003121619.1 NZ_CP117974:5393687-5393968 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A069QL22 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6XRW | |
| AlphaFold DB | Q9I707 |