Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
Location | 38291..39089 | Replicon | plasmid unnamed1 |
Accession | NZ_CP117972 | ||
Organism | Escherichia coli strain B-1109 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | E2QDF3 |
Locus tag | PT723_RS23775 | Protein ID | WP_000072677.1 |
Coordinates | 38291..38812 (-) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | A0A0V9R6Q7 |
Locus tag | PT723_RS23780 | Protein ID | WP_001351987.1 |
Coordinates | 38820..39089 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT723_RS23755 | 35983..36765 | + | 783 | WP_062873814.1 | receptor-recognizing protein | - |
PT723_RS23760 | 36840..37163 | + | 324 | WP_000064173.1 | hypothetical protein | - |
PT723_RS23765 | 37177..37869 | + | 693 | WP_032084069.1 | membrane protein | - |
PT723_RS23770 | 37871..38122 | + | 252 | WP_000901559.1 | hypothetical protein | - |
PT723_RS23775 | 38291..38812 | - | 522 | WP_000072677.1 | GNAT family N-acetyltransferase | Toxin |
PT723_RS23780 | 38820..39089 | - | 270 | WP_001351987.1 | DUF1778 domain-containing protein | Antitoxin |
PT723_RS23785 | 39408..40076 | + | 669 | WP_000161229.1 | AAA family ATPase | - |
PT723_RS23790 | 40082..40435 | + | 354 | WP_162521425.1 | hypothetical protein | - |
PT723_RS23795 | 40474..41151 | - | 678 | WP_077883643.1 | hypothetical protein | - |
PT723_RS23800 | 41530..42270 | + | 741 | WP_062877884.1 | hypothetical protein | - |
PT723_RS23805 | 42314..43654 | + | 1341 | WP_000137333.1 | DnaB-like helicase C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..120874 | 120874 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19392.17 Da Isoelectric Point: 8.6369
>T272609 WP_000072677.1 NZ_CP117972:c38812-38291 [Escherichia coli]
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6P3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6Q7 |