Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3922711..3923329 | Replicon | chromosome |
Accession | NZ_CP117971 | ||
Organism | Escherichia coli strain B-1109 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PT723_RS19370 | Protein ID | WP_001291435.1 |
Coordinates | 3923111..3923329 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PT723_RS19365 | Protein ID | WP_000344800.1 |
Coordinates | 3922711..3923085 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT723_RS19355 (3917800) | 3917800..3918993 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PT723_RS19360 (3919016) | 3919016..3922165 | + | 3150 | WP_137044402.1 | efflux RND transporter permease AcrB | - |
PT723_RS19365 (3922711) | 3922711..3923085 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PT723_RS19370 (3923111) | 3923111..3923329 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PT723_RS19375 (3923501) | 3923501..3924052 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
PT723_RS19380 (3924168) | 3924168..3924638 | + | 471 | WP_000136192.1 | YlaC family protein | - |
PT723_RS19385 (3924802) | 3924802..3926352 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PT723_RS19390 (3926394) | 3926394..3926747 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
PT723_RS19400 (3927126) | 3927126..3927437 | + | 312 | WP_000409911.1 | MGMT family protein | - |
PT723_RS19405 (3927468) | 3927468..3928040 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T272604 WP_001291435.1 NZ_CP117971:3923111-3923329 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT272604 WP_000344800.1 NZ_CP117971:3922711-3923085 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |