Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3282155..3282973 | Replicon | chromosome |
| Accession | NZ_CP117971 | ||
| Organism | Escherichia coli strain B-1109 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0E0Y102 |
| Locus tag | PT723_RS16275 | Protein ID | WP_000771609.1 |
| Coordinates | 3282599..3282973 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0E0Y470 |
| Locus tag | PT723_RS16270 | Protein ID | WP_001285568.1 |
| Coordinates | 3282155..3282508 (+) | Length | 118 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT723_RS16240 (3278222) | 3278222..3278968 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| PT723_RS16245 (3279044) | 3279044..3279175 | + | 132 | Protein_3167 | DUF945 domain-containing protein | - |
| PT723_RS16250 (3279304) | 3279304..3280517 | + | 1214 | WP_180384870.1 | IS3 family transposase | - |
| PT723_RS16255 (3280827) | 3280827..3281303 | + | 477 | WP_137044365.1 | antirestriction protein | - |
| PT723_RS16260 (3281319) | 3281319..3281795 | + | 477 | WP_001423376.1 | RadC family protein | - |
| PT723_RS16265 (3281858) | 3281858..3282079 | + | 222 | WP_000692360.1 | DUF987 domain-containing protein | - |
| PT723_RS16270 (3282155) | 3282155..3282508 | + | 354 | WP_001285568.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| PT723_RS16275 (3282599) | 3282599..3282973 | + | 375 | WP_000771609.1 | TA system toxin CbtA family protein | Toxin |
| PT723_RS16280 (3282970) | 3282970..3283461 | + | 492 | WP_000976860.1 | DUF5983 family protein | - |
| PT723_RS16285 (3283473) | 3283473..3283670 | + | 198 | WP_001391464.1 | DUF957 domain-containing protein | - |
| PT723_RS16290 (3283755) | 3283755..3284597 | + | 843 | WP_001423379.1 | DUF4942 domain-containing protein | - |
| PT723_RS16300 (3285069) | 3285069..3286007 | + | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| PT723_RS16305 (3286062) | 3286062..3286799 | + | 738 | WP_000283667.1 | zinc-binding phosphatase | - |
| PT723_RS16310 (3286823) | 3286823..3287377 | + | 555 | WP_001001921.1 | molecular chaperone YcdY | - |
| PT723_RS16315 (3287479) | 3287479..3287970 | + | 492 | WP_001300785.1 | DUF1097 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | csgG / csgF / csgE / csgD / csgB / csgA / csgC | 3276666..3309217 | 32551 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14006.09 Da Isoelectric Point: 7.2652
>T272603 WP_000771609.1 NZ_CP117971:3282599-3282973 [Escherichia coli]
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y102 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y470 |