Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3282155..3282973 Replicon chromosome
Accession NZ_CP117971
Organism Escherichia coli strain B-1109

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0E0Y102
Locus tag PT723_RS16275 Protein ID WP_000771609.1
Coordinates 3282599..3282973 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0E0Y470
Locus tag PT723_RS16270 Protein ID WP_001285568.1
Coordinates 3282155..3282508 (+) Length 118 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT723_RS16240 (3278222) 3278222..3278968 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
PT723_RS16245 (3279044) 3279044..3279175 + 132 Protein_3167 DUF945 domain-containing protein -
PT723_RS16250 (3279304) 3279304..3280517 + 1214 WP_180384870.1 IS3 family transposase -
PT723_RS16255 (3280827) 3280827..3281303 + 477 WP_137044365.1 antirestriction protein -
PT723_RS16260 (3281319) 3281319..3281795 + 477 WP_001423376.1 RadC family protein -
PT723_RS16265 (3281858) 3281858..3282079 + 222 WP_000692360.1 DUF987 domain-containing protein -
PT723_RS16270 (3282155) 3282155..3282508 + 354 WP_001285568.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PT723_RS16275 (3282599) 3282599..3282973 + 375 WP_000771609.1 TA system toxin CbtA family protein Toxin
PT723_RS16280 (3282970) 3282970..3283461 + 492 WP_000976860.1 DUF5983 family protein -
PT723_RS16285 (3283473) 3283473..3283670 + 198 WP_001391464.1 DUF957 domain-containing protein -
PT723_RS16290 (3283755) 3283755..3284597 + 843 WP_001423379.1 DUF4942 domain-containing protein -
PT723_RS16300 (3285069) 3285069..3286007 + 939 WP_000351317.1 glyoxylate/hydroxypyruvate reductase GhrA -
PT723_RS16305 (3286062) 3286062..3286799 + 738 WP_000283667.1 zinc-binding phosphatase -
PT723_RS16310 (3286823) 3286823..3287377 + 555 WP_001001921.1 molecular chaperone YcdY -
PT723_RS16315 (3287479) 3287479..3287970 + 492 WP_001300785.1 DUF1097 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - csgG / csgF / csgE / csgD / csgB / csgA / csgC 3276666..3309217 32551


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(13-112)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14006.09 Da        Isoelectric Point: 7.2652

>T272603 WP_000771609.1 NZ_CP117971:3282599-3282973 [Escherichia coli]
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 118 a.a.        Molecular weight: 13064.82 Da        Isoelectric Point: 5.9541

>AT272603 WP_001285568.1 NZ_CP117971:3282155-3282508 [Escherichia coli]
VSDTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPR
HQHTVTLYAKGLTCDADTLGSCGYVYLAVYPTPETKK

Download         Length: 354 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y102

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y470

References