Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2748329..2748967 | Replicon | chromosome |
Accession | NZ_CP117971 | ||
Organism | Escherichia coli strain B-1109 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2X7GI71 |
Locus tag | PT723_RS13315 | Protein ID | WP_032231106.1 |
Coordinates | 2748791..2748967 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PT723_RS13310 | Protein ID | WP_001270286.1 |
Coordinates | 2748329..2748745 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT723_RS13290 (2743481) | 2743481..2744422 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
PT723_RS13295 (2744423) | 2744423..2745436 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
PT723_RS13300 (2745454) | 2745454..2746599 | - | 1146 | WP_000047429.1 | ABC transporter substrate-binding protein | - |
PT723_RS13305 (2746844) | 2746844..2748250 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
PT723_RS13310 (2748329) | 2748329..2748745 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
PT723_RS13315 (2748791) | 2748791..2748967 | - | 177 | WP_032231106.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
PT723_RS13320 (2749189) | 2749189..2749419 | + | 231 | WP_000494244.1 | YncJ family protein | - |
PT723_RS13325 (2749511) | 2749511..2751472 | - | 1962 | WP_001491066.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
PT723_RS13330 (2751545) | 2751545..2752081 | - | 537 | WP_000429151.1 | DNA-binding transcriptional regulator SutR | - |
PT723_RS13335 (2752173) | 2752173..2753345 | + | 1173 | WP_250881039.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6680.72 Da Isoelectric Point: 10.9223
>T272602 WP_032231106.1 NZ_CP117971:c2748967-2748791 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPCHPSDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPCHPSDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT272602 WP_001270286.1 NZ_CP117971:c2748745-2748329 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|