Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 369987..370822 | Replicon | chromosome |
| Accession | NZ_CP117971 | ||
| Organism | Escherichia coli strain B-1109 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A3K4KCT6 |
| Locus tag | PT723_RS01775 | Protein ID | WP_000854827.1 |
| Coordinates | 369987..370364 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1Y2XNS0 |
| Locus tag | PT723_RS01780 | Protein ID | WP_001403016.1 |
| Coordinates | 370454..370822 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT723_RS01745 (365352) | 365352..366275 | - | 924 | WP_000535961.1 | carboxylate/amino acid/amine transporter | - |
| PT723_RS01750 (366386) | 366386..367570 | - | 1185 | WP_001172876.1 | sugar efflux transporter | - |
| PT723_RS01755 (367967) | 367967..368128 | - | 162 | Protein_327 | RhuM family protein | - |
| PT723_RS01760 (368363) | 368363..369208 | - | 846 | WP_001825653.1 | DUF4942 domain-containing protein | - |
| PT723_RS01765 (369293) | 369293..369490 | - | 198 | WP_000839236.1 | DUF957 domain-containing protein | - |
| PT723_RS01770 (369502) | 369502..369990 | - | 489 | WP_000761674.1 | DUF5983 family protein | - |
| PT723_RS01775 (369987) | 369987..370364 | - | 378 | WP_000854827.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| PT723_RS01780 (370454) | 370454..370822 | - | 369 | WP_001403016.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PT723_RS01785 (370872) | 370872..371450 | - | 579 | Protein_333 | antitoxin of toxin-antitoxin stability system | - |
| PT723_RS01790 (371616) | 371616..372215 | + | 600 | WP_001195464.1 | inovirus-type Gp2 protein | - |
| PT723_RS01795 (372587) | 372587..372847 | + | 261 | Protein_335 | zinc-ribbon domain-containing protein | - |
| PT723_RS01800 (373379) | 373379..373581 | + | 203 | Protein_336 | AlpA family transcriptional regulator | - |
| PT723_RS01805 (373834) | 373834..374343 | + | 510 | Protein_337 | hypothetical protein | - |
| PT723_RS01810 (374432) | 374432..375052 | + | 621 | WP_137044492.1 | DNA-binding protein | - |
| PT723_RS01815 (375145) | 375145..375378 | + | 234 | WP_001403457.1 | hypothetical protein | - |
| PT723_RS01820 (375431) | 375431..375622 | - | 192 | WP_001825650.1 | DUF4222 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14045.05 Da Isoelectric Point: 7.8840
>T272589 WP_000854827.1 NZ_CP117971:c370364-369987 [Escherichia coli]
MKTLPVLPGQSASSRPSPVEIWQILLARLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITQGKHPEAKR
MKTLPVLPGQSASSRPSPVEIWQILLARLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13648.33 Da Isoelectric Point: 5.9582
>AT272589 WP_001403016.1 NZ_CP117971:c370822-370454 [Escherichia coli]
VSDTLPETNNPNDNHDRPWWGLPCTATPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLPETNNPNDNHDRPWWGLPCTATPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3K4KCT6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Y2XNS0 |