Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 369987..370822 Replicon chromosome
Accession NZ_CP117971
Organism Escherichia coli strain B-1109

Toxin (Protein)


Gene name yeeV Uniprot ID A0A3K4KCT6
Locus tag PT723_RS01775 Protein ID WP_000854827.1
Coordinates 369987..370364 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1Y2XNS0
Locus tag PT723_RS01780 Protein ID WP_001403016.1
Coordinates 370454..370822 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT723_RS01745 (365352) 365352..366275 - 924 WP_000535961.1 carboxylate/amino acid/amine transporter -
PT723_RS01750 (366386) 366386..367570 - 1185 WP_001172876.1 sugar efflux transporter -
PT723_RS01755 (367967) 367967..368128 - 162 Protein_327 RhuM family protein -
PT723_RS01760 (368363) 368363..369208 - 846 WP_001825653.1 DUF4942 domain-containing protein -
PT723_RS01765 (369293) 369293..369490 - 198 WP_000839236.1 DUF957 domain-containing protein -
PT723_RS01770 (369502) 369502..369990 - 489 WP_000761674.1 DUF5983 family protein -
PT723_RS01775 (369987) 369987..370364 - 378 WP_000854827.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
PT723_RS01780 (370454) 370454..370822 - 369 WP_001403016.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PT723_RS01785 (370872) 370872..371450 - 579 Protein_333 antitoxin of toxin-antitoxin stability system -
PT723_RS01790 (371616) 371616..372215 + 600 WP_001195464.1 inovirus-type Gp2 protein -
PT723_RS01795 (372587) 372587..372847 + 261 Protein_335 zinc-ribbon domain-containing protein -
PT723_RS01800 (373379) 373379..373581 + 203 Protein_336 AlpA family transcriptional regulator -
PT723_RS01805 (373834) 373834..374343 + 510 Protein_337 hypothetical protein -
PT723_RS01810 (374432) 374432..375052 + 621 WP_137044492.1 DNA-binding protein -
PT723_RS01815 (375145) 375145..375378 + 234 WP_001403457.1 hypothetical protein -
PT723_RS01820 (375431) 375431..375622 - 192 WP_001825650.1 DUF4222 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14045.05 Da        Isoelectric Point: 7.8840

>T272589 WP_000854827.1 NZ_CP117971:c370364-369987 [Escherichia coli]
MKTLPVLPGQSASSRPSPVEIWQILLARLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13648.33 Da        Isoelectric Point: 5.9582

>AT272589 WP_001403016.1 NZ_CP117971:c370822-370454 [Escherichia coli]
VSDTLPETNNPNDNHDRPWWGLPCTATPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3K4KCT6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Y2XNS0

References