Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 2804971..2806004 | Replicon | chromosome |
| Accession | NZ_CP117970 | ||
| Organism | Enterococcus faecalis strain B-537 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | R3K9G6 |
| Locus tag | PT722_RS13655 | Protein ID | WP_002365229.1 |
| Coordinates | 2805351..2806004 (+) | Length | 218 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | PT722_RS13650 | Protein ID | WP_002365228.1 |
| Coordinates | 2804971..2805354 (+) | Length | 128 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT722_RS13595 (2800800) | 2800800..2801168 | - | 369 | WP_002365216.1 | DUF86 domain-containing protein | - |
| PT722_RS13600 (2801152) | 2801152..2801484 | - | 333 | WP_002399122.1 | nucleotidyltransferase domain-containing protein | - |
| PT722_RS13605 (2801544) | 2801544..2801867 | - | 324 | WP_002399121.1 | hypothetical protein | - |
| PT722_RS13610 (2801907) | 2801907..2802146 | - | 240 | WP_002365219.1 | hypothetical protein | - |
| PT722_RS13615 (2802157) | 2802157..2802309 | - | 153 | WP_002365221.1 | hypothetical protein | - |
| PT722_RS13620 (2802336) | 2802336..2802560 | - | 225 | WP_002365222.1 | hypothetical protein | - |
| PT722_RS13625 (2802792) | 2802792..2802980 | + | 189 | WP_002365223.1 | hypothetical protein | - |
| PT722_RS13630 (2802967) | 2802967..2803128 | - | 162 | WP_002365224.1 | hypothetical protein | - |
| PT722_RS13635 (2803151) | 2803151..2803567 | - | 417 | WP_002365225.1 | DUF961 family protein | - |
| PT722_RS13640 (2803567) | 2803567..2803893 | - | 327 | WP_002365226.1 | hypothetical protein | - |
| PT722_RS13645 (2803979) | 2803979..2804230 | - | 252 | WP_002365227.1 | hypothetical protein | - |
| PT722_RS13650 (2804971) | 2804971..2805354 | + | 384 | WP_002365228.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PT722_RS13655 (2805351) | 2805351..2806004 | + | 654 | WP_002365229.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| PT722_RS13660 (2806043) | 2806043..2806378 | + | 336 | WP_002365231.1 | helix-turn-helix domain-containing protein | - |
| PT722_RS13665 (2806416) | 2806416..2807747 | - | 1332 | WP_002365232.1 | FAD-dependent oxidoreductase | - |
| PT722_RS13670 (2807846) | 2807846..2808781 | - | 936 | WP_171803825.1 | aldo/keto reductase | - |
| PT722_RS13675 (2808796) | 2808796..2809215 | - | 420 | WP_002365234.1 | MerR family transcriptional regulator | - |
| PT722_RS13680 (2809232) | 2809232..2809813 | - | 582 | WP_002365235.1 | histidine phosphatase family protein | - |
| PT722_RS13685 (2810035) | 2810035..2810364 | + | 330 | WP_002365236.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 218 a.a. Molecular weight: 26065.01 Da Isoelectric Point: 6.2394
>T272588 WP_002365229.1 NZ_CP117970:2805351-2806004 [Enterococcus faecalis]
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIITTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIITTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
Download Length: 654 bp
Antitoxin
Download Length: 128 a.a. Molecular weight: 15032.03 Da Isoelectric Point: 5.1063
>AT272588 WP_002365228.1 NZ_CP117970:2804971-2805354 [Enterococcus faecalis]
VQPLAKRLQLLREEKEWTKTYVAKQLGLNNLGTYANWEYGTREPDSEMLSKIASLYDVSTDFLLGRTEERIHLNDKEKIG
KNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKN
VQPLAKRLQLLREEKEWTKTYVAKQLGLNNLGTYANWEYGTREPDSEMLSKIASLYDVSTDFLLGRTEERIHLNDKEKIG
KNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKN
Download Length: 384 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|