Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1193879..1194572 Replicon chromosome
Accession NZ_CP117970
Organism Enterococcus faecalis strain B-537

Toxin (Protein)


Gene name IrrE Uniprot ID A0A2Z6BTE2
Locus tag PT722_RS05465 Protein ID WP_002364356.1
Coordinates 1193879..1194223 (-) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag PT722_RS05470 Protein ID WP_002364355.1
Coordinates 1194240..1194572 (-) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT722_RS05430 (1188950) 1188950..1189996 + 1047 WP_002356990.1 competence type IV pilus assembly protein ComGB -
PT722_RS05435 (1189996) 1189996..1190271 + 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
PT722_RS05440 (1190268) 1190268..1190711 + 444 WP_137007137.1 competence type IV pilus minor pilin ComGD -
PT722_RS05445 (1190739) 1190739..1191887 - 1149 WP_002364359.1 site-specific integrase -
PT722_RS05450 (1191984) 1191984..1192712 - 729 WP_002364358.1 potassium channel family protein -
PT722_RS05455 (1192746) 1192746..1192820 - 75 Protein_1071 ImmA/IrrE family metallo-endopeptidase -
PT722_RS05460 (1192880) 1192880..1193785 - 906 WP_016630909.1 DUF4352 domain-containing protein -
PT722_RS05465 (1193879) 1193879..1194223 - 345 WP_002364356.1 ImmA/IrrE family metallo-endopeptidase Toxin
PT722_RS05470 (1194240) 1194240..1194572 - 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
PT722_RS05475 (1194884) 1194884..1195060 + 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
PT722_RS05480 (1195127) 1195127..1195369 + 243 WP_253257628.1 hypothetical protein -
PT722_RS05485 (1195408) 1195408..1196133 + 726 WP_002364352.1 phage regulatory protein -
PT722_RS05490 (1196159) 1196159..1196347 - 189 WP_002364350.1 YegP family protein -
PT722_RS05495 (1196402) 1196402..1196611 + 210 WP_002399426.1 hypothetical protein -
PT722_RS05500 (1196648) 1196648..1196986 + 339 WP_002364347.1 hypothetical protein -
PT722_RS05505 (1197271) 1197271..1197825 - 555 WP_002357006.1 hypothetical protein -
PT722_RS05510 (1198045) 1198045..1198362 + 318 WP_002357007.1 hypothetical protein -
PT722_RS05515 (1198355) 1198355..1199089 + 735 WP_002364345.1 ERF family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1190295..1229526 39231


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-81)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13704.62 Da        Isoelectric Point: 5.8535

>T272584 WP_002364356.1 NZ_CP117970:c1194223-1193879 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT272584 WP_002364355.1 NZ_CP117970:c1194572-1194240 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6BTE2

Antitoxin

Source ID Structure

References