Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 291960..292552 | Replicon | chromosome |
Accession | NZ_CP117968 | ||
Organism | Allobacillus halotolerans strain BCRC 17939 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PT602_RS01710 | Protein ID | WP_216687588.1 |
Coordinates | 292229..292552 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PT602_RS01705 | Protein ID | WP_216687582.1 |
Coordinates | 291960..292229 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT602_RS01690 | 287756..287953 | - | 198 | WP_216687579.1 | hypothetical protein | - |
PT602_RS01695 | 288204..289571 | + | 1368 | WP_216687580.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
PT602_RS01700 | 289960..291399 | + | 1440 | WP_216687581.1 | DUF4901 domain-containing protein | - |
PT602_RS01705 | 291960..292229 | + | 270 | WP_216687582.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PT602_RS01710 | 292229..292552 | + | 324 | WP_216687588.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PT602_RS01715 | 292605..292823 | - | 219 | WP_246569289.1 | hypothetical protein | - |
PT602_RS01720 | 292994..293098 | - | 105 | WP_144161970.1 | YjcZ family sporulation protein | - |
PT602_RS01725 | 293450..294913 | + | 1464 | WP_216687583.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
PT602_RS01730 | 295069..295749 | + | 681 | WP_216687584.1 | hypothetical protein | - |
PT602_RS01735 | 295733..297439 | + | 1707 | WP_216687585.1 | GMC family oxidoreductase N-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11995.83 Da Isoelectric Point: 7.8563
>T272572 WP_216687588.1 NZ_CP117968:292229-292552 [Allobacillus halotolerans]
MEVPDKGDLIYLNFSPQSGHEQSGHRPAIVLSPKLFNQNTFLIACPITNQEKGYPFEVKIPSGLKVKGVILTDQIRSVEW
RSRNVKIVDQAPAETTDECLKKIATFL
MEVPDKGDLIYLNFSPQSGHEQSGHRPAIVLSPKLFNQNTFLIACPITNQEKGYPFEVKIPSGLKVKGVILTDQIRSVEW
RSRNVKIVDQAPAETTDECLKKIATFL
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|