Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 222132..222763 | Replicon | chromosome |
| Accession | NZ_CP117968 | ||
| Organism | Allobacillus halotolerans strain BCRC 17939 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | PT602_RS01320 | Protein ID | WP_144089539.1 |
| Coordinates | 222413..222763 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | PT602_RS01315 | Protein ID | WP_144089538.1 |
| Coordinates | 222132..222407 (+) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT602_RS01295 | 217238..218593 | + | 1356 | WP_212371692.1 | IS1182 family transposase | - |
| PT602_RS01300 | 218719..219087 | + | 369 | WP_144162546.1 | holo-ACP synthase | - |
| PT602_RS01305 | 219252..220274 | + | 1023 | WP_216687950.1 | outer membrane lipoprotein carrier protein LolA | - |
| PT602_RS01310 | 220864..221997 | + | 1134 | WP_216687949.1 | alanine racemase | - |
| PT602_RS01315 | 222132..222407 | + | 276 | WP_144089538.1 | antitoxin | Antitoxin |
| PT602_RS01320 | 222413..222763 | + | 351 | WP_144089539.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PT602_RS01325 | 223025..223900 | + | 876 | WP_144162552.1 | STAS domain-containing protein | - |
| PT602_RS01330 | 223906..224265 | + | 360 | WP_246569343.1 | STAS domain-containing protein | - |
| PT602_RS01335 | 224265..224666 | + | 402 | WP_144162556.1 | anti-sigma regulatory factor | - |
| PT602_RS01340 | 224680..225693 | + | 1014 | WP_216687947.1 | PP2C family protein-serine/threonine phosphatase | - |
| PT602_RS01345 | 225758..226084 | + | 327 | WP_216687946.1 | STAS domain-containing protein | - |
| PT602_RS01350 | 226084..226563 | + | 480 | WP_216687945.1 | anti-sigma B factor RsbW | - |
| PT602_RS01355 | 226535..227323 | + | 789 | WP_216687944.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 217238..218593 | 1355 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13036.08 Da Isoelectric Point: 5.1239
>T272571 WP_144089539.1 NZ_CP117968:222413-222763 [Allobacillus halotolerans]
MYVKRGDVFYADLTPVVGSEQGGVRPVLIIQNNIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAEKYHFEKNSVILLEQI
RTIDKQRLTDKLTTLDEFLMNQVDEALQISLGLIDL
MYVKRGDVFYADLTPVVGSEQGGVRPVLIIQNNIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAEKYHFEKNSVILLEQI
RTIDKQRLTDKLTTLDEFLMNQVDEALQISLGLIDL
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|