Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1746488..1747125 | Replicon | chromosome |
Accession | NZ_CP117967 | ||
Organism | Veillonella rogosae strain AC2811 AN NA |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PT376_RS08190 | Protein ID | WP_274204420.1 |
Coordinates | 1746715..1747125 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C4FMM5 |
Locus tag | PT376_RS08185 | Protein ID | WP_005384838.1 |
Coordinates | 1746488..1746718 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT376_RS08175 | 1743888..1744745 | + | 858 | WP_274205222.1 | methylenetetrahydrofolate reductase | - |
PT376_RS08180 | 1745043..1745795 | - | 753 | WP_274204419.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
PT376_RS08185 | 1746488..1746718 | + | 231 | WP_005384838.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PT376_RS08190 | 1746715..1747125 | + | 411 | WP_274204420.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PT376_RS08195 | 1747201..1749072 | - | 1872 | WP_274204421.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG | - |
PT376_RS08200 | 1749420..1750805 | - | 1386 | WP_274204422.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
PT376_RS08205 | 1751058..1751858 | - | 801 | WP_274204423.1 | RNA-binding cell elongation regulator Jag/EloR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15323.74 Da Isoelectric Point: 6.6380
>T272570 WP_274204420.1 NZ_CP117967:1746715-1747125 [Veillonella rogosae]
MKYMLDTNICIYAIKQEPEVVLQKILKHHPSDICISSITYAELMHGVEKSQSKDKNRLALTLLLSPIQIVDFDSHTAEEY
GKIKADLQSQGKVIGPMDLLIASHAKSKGLTIVTNNTKEFERVTQLEVEDWSKPLS
MKYMLDTNICIYAIKQEPEVVLQKILKHHPSDICISSITYAELMHGVEKSQSKDKNRLALTLLLSPIQIVDFDSHTAEEY
GKIKADLQSQGKVIGPMDLLIASHAKSKGLTIVTNNTKEFERVTQLEVEDWSKPLS
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|