Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 3208387..3208952 | Replicon | chromosome |
Accession | NZ_CP117966 | ||
Organism | Roseburia hominis strain OB EAV1 11 DCM |
Toxin (Protein)
Gene name | relE | Uniprot ID | C7H6P5 |
Locus tag | PT374_RS14695 | Protein ID | WP_002596328.1 |
Coordinates | 3208387..3208677 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | C7H6P4 |
Locus tag | PT374_RS14700 | Protein ID | WP_005924829.1 |
Coordinates | 3208674..3208952 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT374_RS14665 | 3203966..3204427 | + | 462 | WP_007860242.1 | hypothetical protein | - |
PT374_RS14670 | 3204883..3205296 | + | 414 | WP_007860240.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
PT374_RS14675 | 3205400..3205852 | + | 453 | WP_274271263.1 | RNA polymerase subunit sigma-24 | - |
PT374_RS14680 | 3205863..3206324 | + | 462 | WP_007860238.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
PT374_RS14685 | 3206353..3206643 | + | 291 | WP_007860237.1 | DUF3847 domain-containing protein | - |
PT374_RS14690 | 3206834..3208279 | + | 1446 | WP_076917517.1 | MobQ family relaxase | - |
PT374_RS14695 | 3208387..3208677 | - | 291 | WP_002596328.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
PT374_RS14700 | 3208674..3208952 | - | 279 | WP_005924829.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PT374_RS14705 | 3209079..3209477 | + | 399 | WP_007860226.1 | cysteine-rich VLP domain-containing protein | - |
PT374_RS14710 | 3209591..3210325 | + | 735 | WP_107630810.1 | phage replisome organizer N-terminal domain-containing protein | - |
PT374_RS14715 | 3210322..3211185 | + | 864 | WP_107630811.1 | ATP-binding protein | - |
PT374_RS14720 | 3211229..3211423 | + | 195 | WP_274271266.1 | transposon-encoded TnpW family protein | - |
PT374_RS14725 | 3211501..3211866 | + | 366 | WP_274271267.1 | hypothetical protein | - |
PT374_RS14730 | 3212015..3212647 | + | 633 | WP_249397227.1 | transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3198701..3209477 | 10776 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11112.87 Da Isoelectric Point: 8.0630
>T272567 WP_002596328.1 NZ_CP117966:c3208677-3208387 [Roseburia hominis]
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M4XBM1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M4XB19 |