Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 3208387..3208952 Replicon chromosome
Accession NZ_CP117966
Organism Roseburia hominis strain OB EAV1 11 DCM

Toxin (Protein)


Gene name relE Uniprot ID C7H6P5
Locus tag PT374_RS14695 Protein ID WP_002596328.1
Coordinates 3208387..3208677 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C7H6P4
Locus tag PT374_RS14700 Protein ID WP_005924829.1
Coordinates 3208674..3208952 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT374_RS14665 3203966..3204427 + 462 WP_007860242.1 hypothetical protein -
PT374_RS14670 3204883..3205296 + 414 WP_007860240.1 sigma factor-like helix-turn-helix DNA-binding protein -
PT374_RS14675 3205400..3205852 + 453 WP_274271263.1 RNA polymerase subunit sigma-24 -
PT374_RS14680 3205863..3206324 + 462 WP_007860238.1 sigma factor-like helix-turn-helix DNA-binding protein -
PT374_RS14685 3206353..3206643 + 291 WP_007860237.1 DUF3847 domain-containing protein -
PT374_RS14690 3206834..3208279 + 1446 WP_076917517.1 MobQ family relaxase -
PT374_RS14695 3208387..3208677 - 291 WP_002596328.1 type II toxin-antitoxin system YafQ family toxin Toxin
PT374_RS14700 3208674..3208952 - 279 WP_005924829.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PT374_RS14705 3209079..3209477 + 399 WP_007860226.1 cysteine-rich VLP domain-containing protein -
PT374_RS14710 3209591..3210325 + 735 WP_107630810.1 phage replisome organizer N-terminal domain-containing protein -
PT374_RS14715 3210322..3211185 + 864 WP_107630811.1 ATP-binding protein -
PT374_RS14720 3211229..3211423 + 195 WP_274271266.1 transposon-encoded TnpW family protein -
PT374_RS14725 3211501..3211866 + 366 WP_274271267.1 hypothetical protein -
PT374_RS14730 3212015..3212647 + 633 WP_249397227.1 transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3198701..3209477 10776


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-94)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-90)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11112.87 Da        Isoelectric Point: 8.0630

>T272567 WP_002596328.1 NZ_CP117966:c3208677-3208387 [Roseburia hominis]
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK

Download         Length: 291 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10247.66 Da        Isoelectric Point: 4.4692

>AT272567 WP_005924829.1 NZ_CP117966:c3208952-3208674 [Roseburia hominis]
MAGNTTNISIRMDADLKAQADALFTELGMNLTTAFNIFVRQSLREGGIPFEVRLEQPNKETVAAMLEAERIAKDPSVKGY
NDLDELFADLKR

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1M4XBM1

Antitoxin

Source ID Structure
AlphaFold DB A0A1M4XB19

References