Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 2273896..2274437 | Replicon | chromosome |
| Accession | NZ_CP117963 | ||
| Organism | Faecalibacterium prausnitzii strain AP34BHI | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PT301_RS10950 | Protein ID | WP_118551719.1 |
| Coordinates | 2274162..2274437 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PT301_RS10945 | Protein ID | WP_118551721.1 |
| Coordinates | 2273896..2274165 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT301_RS10925 | 2269899..2270774 | + | 876 | WP_274235909.1 | ABC transporter permease | - |
| PT301_RS10930 | 2270774..2271715 | + | 942 | WP_118551725.1 | ABC transporter permease | - |
| PT301_RS10935 | 2271738..2272793 | + | 1056 | WP_097792636.1 | ABC transporter ATP-binding protein | - |
| PT301_RS10940 | 2272786..2273727 | + | 942 | WP_274235523.1 | ATP-binding cassette domain-containing protein | - |
| PT301_RS10945 | 2273896..2274165 | + | 270 | WP_118551721.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PT301_RS10950 | 2274162..2274437 | + | 276 | WP_118551719.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| PT301_RS10955 | 2274530..2276056 | - | 1527 | WP_118551717.1 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase | - |
| PT301_RS10960 | 2276178..2276948 | - | 771 | WP_097792639.1 | triose-phosphate isomerase | - |
| PT301_RS10965 | 2277039..2278247 | - | 1209 | WP_118551715.1 | phosphoglycerate kinase | - |
| PT301_RS10970 | 2278499..2278702 | - | 204 | WP_097792641.1 | PTS ascorbate transporter subunit IIC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10835.54 Da Isoelectric Point: 8.0414
>T272565 WP_118551719.1 NZ_CP117963:2274162-2274437 [Faecalibacterium prausnitzii]
MKYEIKPSSRFKKDMKLVKKRGYDPRLIETVIKTLANGEPLDKKYRDHILVGDYSGFHECHITPDWLLIYQIYDEELYLL
LSRTGTHSDLF
MKYEIKPSSRFKKDMKLVKKRGYDPRLIETVIKTLANGEPLDKKYRDHILVGDYSGFHECHITPDWLLIYQIYDEELYLL
LSRTGTHSDLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|